KEGG   Parabacteroides distasonis: BDI_1048Help
Entry
BDI_1048          CDS       T00549                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pdi  Parabacteroides distasonis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214055..1215434
Genome map
AA seq 459 aa AA seqDB search
MRKTIYAKMAALPVGLCALAFAVTSCGSSEYKKFADNEGKQVASILRENDCLACHSENAP
LPFYGNLPLIGPVVQADMKEAVHYVDLTAMVEALENGQPVSEVDLAKVENTALSGSMPPA
KYSHMPMHWGTSLDDNEKAVIISWAKNVRKDRFTTETVAEEFKNEPLQPLMKSLPTDPAK
VELGFALYHDTRLSADNTISCATCHGLNTGGVDRKQYSEGINGQFGGVNAPTVYNAALNF
VQFWDGRAADLKEQAAGPPLNPVEMGCTSFDQICEALAQDKDFTKKFTEVYPEGYSQSTI
TDAIAEFEKTLLTPSRFDKYLMGDKNALTAEELEGYQLFKDNKCATCHVGVNVGGQSYEF
MGIKNSYFDYRNTGLTDGDNGRYAVTKKESDRHKFKTPTLRNVMLTYPYMHDGTVASVED
AIRIMHEFQIGKEINDVEVEKIVVFLRTLNGEYNGKMLQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaacaatttatgctaaaatggcggcattaccggtaggactctgcgctttagcc
tttgcggttacctcgtgcggttcttccgaatacaagaaatttgccgacaatgaaggtaag
caagtggcctctatcctgcgggaaaacgactgtttggcctgccactctgaaaatgcgcct
ctgccattttacggtaatttaccgttgatcggtcccgtagtacaggcagacatgaaggag
gccgttcactatgtggacttgactgctatggtggaagccttggagaacgggcagcccgtt
tcagaggttgatttggcgaaggtggagaatacggccctaagcggctctatgcccccggct
aagtattcccatatgccgatgcactggggaaccagccttgacgacaatgagaaagcggtg
atcatctcatgggcgaagaatgtccgtaaagatcgtttcacgaccgaaaccgtagcggaa
gaatttaagaatgagcctcttcagcctctaatgaagagcttgcctacagatccggcgaag
gtagagttgggttttgccctgtatcatgatactcgtttgtctgcggacaatacgatctct
tgcgctacttgccacggattgaacacaggtggtgtagaccgtaagcaatattcggaaggt
attaatggacagttcggtggtgttaacgctccgaccgtatataatgcggcgcttaatttc
gttcaattttgggacggacgtgcggcagacctaaaagagcaagcggctggtcctccattg
aacccagtggaaatgggttgtacctcattcgaccagatttgcgaggctttagcgcaagat
aaggatttcacgaagaaattcacggaagtgtatccggaaggttattctcaatctacgatc
acggacgctatcgctgagtttgagaagaccttgcttacgccgagtcgtttcgacaaatac
ttgatgggagataaaaacgcgcttacagcggaagaattagagggttatcaactattcaag
gacaataaatgcgctacttgtcacgttggtgtaaatgtcggtggtcaatcttacgagttc
atgggtatcaagaacagctatttcgattaccggaatacagggttgacggacggtgataac
ggacgctatgccgtgactaagaaagaatccgatcgtcataagttcaaaaccccgacactt
cgtaacgtgatgctgacttatccgtacatgcacgacggaacggtagcctctgtagaggat
gcgatccgtatcatgcatgagttccagatcggaaaggagatcaatgatgtagaagttgaa
aaaatcgttgtttttctaaggactttgaacggagaatataatggaaaaatgcttcaataa

DBGET integrated database retrieval system