KEGG   Parabacteroides distasonis: BDI_1302Help
Entry
BDI_1302          CDS       T00549                                 

Definition
glycosyltransferase family dolichyl-phosphate beta-D-mannosyltransferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
pdi  Parabacteroides distasonis
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1511573..1512322)
Genome map
AA seq 249 aa AA seqDB search
MSDSIVIIPTYNEKENIENIIRAVFGLEKVFHILVIDDGSPDGTAAIVKGLQKEFPERLF
IVERKGKLGLGTAYIRGFKWAIEHKYDFIFEMDADFSHNPNDLPKLYAACTGQGADVAIG
SRYCNGVNVVNWPLGRVLMSYFASVYVRIVTGMKIQDTTAGFKCYRREVLETIDLDRVHF
KGYAFQVEMKFTAYKCGFKLVEVPIIFINRALGVSKMNSSIFGEALFGVLQLKWWSFFRK
YPRKHASHA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacagtatcgtcattattcctacatacaacgagaaggagaatattgagaatatc
attcgtgccgtgttcgggctggagaaagtgtttcatatcttggtgatcgatgatggctct
ccggatgggacggcggctatcgtgaagggcttgcagaaggagttcccggagcgtcttttt
atcgtggagcgtaaagggaagctgggattgggtaccgcttatatccggggttttaaatgg
gctatcgagcataaatatgattttatttttgagatggacgccgatttcagtcataatccc
aatgacctgccgaagctatacgccgcttgtaccgggcagggtgccgacgtagccatcggg
tcgaggtattgcaacggggtgaatgtggtgaactggccgttgggccgtgtgttgatgtct
tatttcgcctcggtgtatgtccgtatcgtcacgggtatgaagatacaggatacgacggcg
ggttttaaatgttaccgccgtgaggtgctggagacgatcgatctggaccgtgtccatttc
aagggatacgcctttcaggtggagatgaagtttacggcttataagtgcggctttaagctc
gtggaggtgccgatcatctttatcaaccgtgccttgggtgtctccaagatgaactcttcg
atattcggggaggctttattcggcgtccttcaattgaaatggtggagtttcttcaggaag
tatccgaggaaacatgcgagccatgcctaa

DBGET integrated database retrieval system