KEGG   Parabacteroides distasonis: BDI_1518Help
Entry
BDI_1518          CDS       T00549                                 

Definition
beta-glycosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pdi  Parabacteroides distasonis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pdi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1775003..1777309)
Genome map
AA seq 768 aa AA seqDB search
MDSMKKKIAYLLLLLMLIPVGSFAKEKRTFEIKDGHFYVNGKVTPILSGEMHYPRIPHQY
WRHRLRMMRAMGLNTVATYVFWNLHETEPGKWDFEGDKNLAEYIRIAGEEGLMVILRPGP
YVCAEWEFGGYPWWLQNIPGMEIRRDNPEFLKRTKLYIDKLYEQVGDLQVSKGGPIIMVQ
AENEFGSYVAQRKDIPLEEHRRYNAKIKRQLADAGFNVPLFTSDGSWLFEGGSTPGALPT
ANGESNVENLKKVVNEYHGGVGPYMVAEFYPGWLMHWAEPFPDISDSGIARQTETYLQND
VSFNFYMVHGGTNFGFTSGANYDKKHDIQPDLTSYDYDAPISEAGWVTPKFDSIRNVIRK
YVTYDVPEAPAPIPLIEIPSISLTKVADVLALAKEGEPVASPTPLTFEQLNQGYGYVLYS
THFNQPLKGRLEIPGLRDYATIYVDGERVGELNRCFNQYAMEIDIPFNATLDILVENMGR
INYGEEIVRNTKGIISSVKINGSEISDWKMYKLPMDRMPALVSGEPYVYKNGSPEVAALG
NKPVLYEGTFHLSDTGDTFIDMEDWGKGIIFINGVNIGRYWYAGPQQTLYIPGVWLNKGE
NKIVIYEQLNNDRKSSVRTVKTPVLTKLKKIAAMEKKNRLMEKTVSPFSVDETMRRIEEI
IKSQGGSVFAMFDHGRNASEVGMKLPPNKVIVFGSPKVGTLLMQQDPSISLELPLRISVW
EDADGKVWVGSPNLETIASEYGMENSGVIEKMQEAVTNIVSKSIAGSR
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggattccatgaaaaagaaaatcgcctatctattgctccttttgatgctgatacctgtc
ggctcgttcgccaaggagaaacgtacgttcgagatcaaggacggtcatttttatgtaaac
gggaaggtaaccccgatcctctcgggtgagatgcattaccctcgtatccctcatcaatat
tggcggcatcgccttcggatgatgcgagcgatgggcttgaatacggtcgctacctatgtc
ttctggaacctgcacgagacggagccgggtaaatgggatttcgagggagacaagaatctg
gccgagtatatccggatagcgggagaggagggattgatggtgatcctccgtcccggcccg
tacgtatgcgccgagtgggagttcggtggttatccgtggtggttgcagaatataccgggc
atggagatccgccgggataacccggagttcttgaaacgcacgaagctttatatcgataag
ctttacgagcaggtcggcgacttgcaggtgtcgaaaggcggccctatcatcatggtgcag
gccgagaacgagttcggctcttacgtggcgcaacgtaaggatatccccttggaggagcat
cgccgctacaacgccaagatcaagcggcaattggcggacgccggtttcaacgtgcctctg
ttcacctcggacggaagctggttgttcgagggcggttccaccccgggagcgttgcctacg
gcgaacggggagagcaacgtggagaacttgaaaaaggtggtgaacgagtatcacggggga
gtaggcccgtatatggtagccgagttttatcccggttggctgatgcactgggcggaacca
ttccccgatataagcgattccggcatagcgaggcagacggagacgtacctccaaaacgat
gtctctttcaatttctatatggttcatggcggtacgaatttcggtttcaccagtggcgcc
aattacgacaagaagcatgatatccagccggacttgaccagctacgactacgacgccccg
atcagcgaggcgggttgggtgaccccgaagttcgactcgatccgcaacgtgatccggaaa
tacgtcacttatgacgtccccgaggccccagcccctataccgctgatcgagatcccgtcg
atctccttgacgaaggtagccgatgtgttggccttggcgaaagaaggggaaccagtagcg
tctccgacacctctcacgttcgagcaattgaaccaaggatacggctacgtcttgtactct
acccatttcaaccaacccctgaaaggccgtttggagataccgggcttgcgtgattacgct
acgatctacgtggatggcgagcgtgtcggcgagttaaaccgttgcttcaaccaatatgcg
atggaaatcgatatcccgttcaacgctaccttggacatcttggtggagaacatggggcgt
atcaattatggcgaggagatcgtacgcaatacgaaggggatcatcagctcggtcaagatt
aacggcagcgagatatcggactggaagatgtacaagctcccgatggaccggatgccggct
ttggtctccggcgaaccttatgtctataagaatggctcgcccgaggtagcggcgttgggg
aataagccggttctctacgagggaaccttccacctgtccgataccggcgatacgttcatc
gacatggaggattggggaaagggcattattttcatcaatggcgtcaatatcggccgctat
tggtatgccggccctcagcaaacgctttacataccgggcgtatggctgaacaaaggagag
aataagatcgttatttatgagcagctgaataatgaccggaagtcgagcgtacggacggtc
aagactcctgtcttgacaaaactaaagaaaattgcagccatggagaaaaagaatcgtttg
atggaaaaaacagtaagcccgtttagcgtggatgagacgatgcggcggatcgaggagatt
atcaagtctcaaggaggttccgtgttcgccatgttcgatcatgggcgaaacgctagcgag
gtagggatgaagctgcctccgaataaggtgatcgtcttcggctcaccgaaagtcgggact
ttattgatgcagcaagatccgtctatctctttggagctgccgctacgtatctccgtttgg
gaagatgcggacggcaaggtttgggtcggttccccgaatctggagacgatcgcctccgaa
tacgggatggaaaacagcggcgtcatcgagaagatgcaagaggccgtaacgaatatcgtg
agtaaatcgatagctggtagccggtaa

DBGET integrated database retrieval system