KEGG   Parabacteroides distasonis: BDI_1620Help
Entry
BDI_1620          CDS       T00549                                 

Definition
glycoside hydrolase
Organism
pdi  Parabacteroides distasonis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1899512..1901866)
Genome map
AA seq 784 aa AA seqDB search
MKKKSVWALALAAMLMWVGKPAAAAVNESFDPVEYVNPLMGTQSSYELSTGNTYPAIARP
WGMNFWTPQTGKMGDGWQYVYTANKIRGFKQTHQPSPWINDYGQFAIMPVVGKPEFDQDK
RASWFSHKGEIAKAYYYKVYLAEHDVVTELTPTDRAAMFRFTFPENEHSYIVVDALDKGS
YIKVIPEENKIIGYSTKNSGGVPDNFKNYFVIEFDKPFTYEATFADASLKEGTKEQTSDH
VGAVIGFKTKKGEIVHAKVASSFISFDQAAINMKELGNDNFDTLVQKGKDVWNEHLSKIE
VEGGDLDQYRTFYSCFYRSLLFPRKFYEINAQGEVVHYSPYNGEVLPGYMFTDTGFWDTF
RSLFPFLNLMFPSVNKEMQEGLINTYKESGFFPEWASPGHRGCMVGNNSASILVDAYMKG
VKVDDLETLYKGLIHGTENVHPTVSSTGRLGHEYYNKLGYVPYDVKINENAARTLEYAYN
DWCIWQIAKQLGRPKKELDLYARRALNYKNLYDKETKLMRGKNENGEFMAPFSPLKWGDA
FTEGNSWHYSWSVFHDPQGLIDLMGGKDSFVMMLDSVFAVPPLFDDSYYGGVIHEIREMT
VMNMGNYAHGNQPIQHMIYLYNYAGQPWKAQYWLRQVMNKMYTPGPDGYCGDEDNGQTSA
WYVFSALGFYPVAPGTTQYVLGAPLFKKATIHFENGNNLVINAPNNSDKNIYIESMTFNG
KNYTKNYLDHNDLFKGGVIDFKMGDKPNMNRGINPEDMPYSFSVNEEGINKLSPISVKPS
KKKK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaagcgtttgggctttagctttagcggcgatgctgatgtgggtggggaaa
cctgcggcagcggctgtgaatgagtcttttgacccagtagagtatgtaaacccgctaatg
gggacgcaatcttcctatgagttgtctacaggaaatacctatccggcgatcgctcgtccg
tggggtatgaatttctggactcctcagactggtaagatgggagatggatggcagtatgta
tatacggctaacaagatccgtggttttaaacagacccaccagccaagtccgtggatcaat
gattacggacaatttgcgatcatgccggtggttggtaaaccggagttcgaccaagataaa
cgtgcgagctggttctctcacaaaggggagatcgccaaggcttattattataaggtatat
ttggcggagcatgatgtggtgacggaattaacgccgacagatcgtgcggctatgttccgt
ttcactttcccggaaaacgagcattcttatatcgtggtggatgccttggataagggctct
tatatcaaggtaattccggaggagaataagatcatcggttattcaacgaagaatagcggt
ggggttcccgataatttcaagaattactttgtgatcgagtttgataaacctttcacatac
gaggctacatttgctgacgcttccttgaaagagggaacgaaggaacaaacgagtgaccat
gtaggagccgttatcggtttcaagacgaagaaaggtgagatcgtccacgctaaggtggct
tcctcatttattagcttcgatcaggccgctatcaatatgaaggaattaggtaacgataac
tttgatactttggttcagaaaggtaaggatgtttggaatgagcatctgagcaagatcgag
gttgaaggtggagatttggatcaataccgtactttctattcttgcttctatcgttcattg
ttgttccctcgtaagttctatgagatcaacgctcaaggcgaggtggttcattacagcccg
tataatggtgaggtattacccggttatatgtttaccgataccggattctgggatacgttc
cgtagtttgttcccattcttgaacttgatgttcccgtctgtaaacaaggaaatgcaagag
ggtttgatcaatacgtataaggaaagcggcttcttcccggaatgggcaagtccgggccac
cgtggttgcatggtcggtaataactcggcatctatcttggtagacgcttatatgaaaggc
gtgaaggttgacgatttggagactctatataaaggtttgatccatggtacggaaaacgtt
catccgacggtttcttctacaggacgtctggggcatgaatattataataagttgggatat
gttccttacgatgtgaagattaacgagaatgccgctcgtacattggaatatgcttacaat
gactggtgtatctggcagatcgctaaacaactaggccgtccgaaaaaggaattggattta
tatgcccgtcgtgcgttgaactataagaacctgtacgacaaggaaaccaagttgatgcgt
ggcaagaatgagaatggcgagttcatggctccgttctctccgctgaaatggggtgacgct
ttcacggaaggtaatagctggcactattcatggtctgtattccacgatcctcagggattg
atcgacttgatgggcggtaaggattcatttgtgatgatgcttgactccgtatttgctgtg
ccgcctttgttcgatgatagctactacggtggtgtgatccacgagatccgcgagatgacc
gtgatgaatatgggtaactacgctcacggtaaccagccgatccagcatatgatttattta
tacaactatgcgggtcaaccttggaaggctcaatattggttgcgtcaagtaatgaataag
atgtatactccgggtccggatggttattgcggtgatgaggataatggccagacttccgct
tggtatgtattctcagcgttaggattctatccggtagctccgggtacgacccaatatgtg
ttgggcgctccgctgttcaagaaggctacgatccattttgagaatggaaacaacttggtg
atcaacgccccgaacaacagcgataagaatatctatatcgaatctatgacgttcaacggc
aagaactacaccaagaattatttggatcataacgatttgtttaagggtggcgtgattgac
ttcaagatgggtgacaagccgaatatgaatcgtggtattaatccggaggatatgccttac
tcattctccgtaaacgaggaagggatcaataaactttcccctatttccgtaaaacctagt
aaaaagaagaaataa

DBGET integrated database retrieval system