KEGG   Parabacteroides distasonis: BDI_1657Help
Entry
BDI_1657          CDS       T00549                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pdi  Parabacteroides distasonis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BDI_1657
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BDI_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957395..1958318)
Genome map
AA seq 307 aa AA seqDB search
MKDLRNHNILVVGSSNTDMVIKTNHLPRPGETVLGGTFFMNPGGKGANQAVAVARLGGQV
SFICKTGSDIFGHQSQQLFEEEGIDTSYIFSDPKNPSGVALITVDAHAENCIVVASGANA
NLLPSDLAKSEEAIEKADLILMQLEIPMDTVEFVAKMASKKNKRVILNPAPAQTLSATLL
RHLYMITPNETEAEMISGVKITDEVSAKKAAQVIMEMGVQNVIVTLGSKGALIYCDSMVD
MVPAIKVEAVDTTAAGDIFNGALTVALAEGRDLREAVRFACKASAISVTRVGAQSSAPYR
NEVDIFD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacggaatcataatatattggttgttggaagtagcaataccgatatggtc
ataaagacgaatcatctccctcgtccgggagagacggtattgggcggaacattttttatg
aacccgggtgggaaaggagcgaatcaagcggttgctgttgcgcggttagggggacaggtc
tcgtttatttgtaaaacaggcagtgatatattcggacatcaatcccagcagctatttgag
gaagaggggattgatacttcctatattttctcagatccgaagaatccatctggcgtagcg
ttgattacggtggatgctcatgctgaaaactgtattgtggtggcctccggagctaatgct
aatctattaccttctgatttagcgaaatcggaagaggcgatagaaaaagccgatttgatt
ttaatgcaattggagattcctatggatactgtcgagtttgtcgctaagatggcatcgaag
aagaacaaacgggtaatattgaatccggctccagctcaaactttgtcggctacgttactc
cggcatctgtatatgattaccccgaatgagacagaggcagagatgatctctggcgtgaag
atcacggatgaggtttccgcgaagaaggctgcgcaagttataatggagatgggagtacag
aacgtaatcgttactttaggctcaaaaggagctttgatctattgtgattccatggtagat
atggttcctgcgataaaagtggaagccgttgatactactgccgccggggatattttcaac
ggcgctttaacggtggctttggctgaggggcgggatttaagggaagccgtgagattcgct
tgcaaagcttccgccatttccgtgactcgtgtgggagcgcaatcttccgctccttatcgg
aatgaggtggatatttttgattaa

DBGET integrated database retrieval system