KEGG   Parabacteroides distasonis: BDI_1664Help
Entry
BDI_1664          CDS       T00549                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00010  Glycolysis / Gluconeogenesis
pdi00052  Galactose metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_1664
   00052 Galactose metabolism
    BDI_1664
Enzymes [BR:pdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BDI_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABR43416
UniProt: A6LCK2
Position
1967017..1968093
Genome map
AA seq 358 aa AA seqDB search
MKNINTLSGLSVANFSKQIDGKETALYTLCNKVGAELAITNYGAKIVSLMVPDKNGKMTD
VVTGHNSIEEYLTSEEPYFGAICGRYGNRIAAGKFTIDGITYDKLAINNGPNSLHGGIKG
FNAVVWDAKQIDEQTIELKYTSADGEEGFPGELKTTVTYHLTNENEVVISYQASTDKPTV
LNLTNHSYFNLSGAGDPYIGDHILTINADYYLPTDNTAIPYGPKEKVEGTPMDFRTPHEV
GERINDNFEQLIFGKGYDHTYILNKEDNELSYCARCSSPKTGIVMETYTTQPGVQLYTGN
WMTGNFEGKNGQRYPERAALCLETQHFPDSPNKPEYPTTELRPGEVFQSTTIYKFSVE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacataaatacactgtcgggcttgtctgttgctaacttcagcaagcaaattgac
gggaaagaaacggcgctttataccctgtgtaacaaggttggagcagagctagcgatcacg
aattatggagcgaaaatcgtctcactgatggttccggataagaacggaaaaatgaccgat
gtcgttactggccataattcgattgaagagtacttaacatcagaagaaccttatttcggt
gccatttgcggtcgttatggaaatcgtatcgccgctggaaaattcacgatcgacggtatt
acttatgacaaattagccataaataatggccccaatagcttgcatggcggaatcaaggga
ttcaatgcggtcgtatgggacgccaaacaaatagacgagcaaaccattgagttgaaatat
acctccgccgatggcgaggaaggtttccccggagaactaaagacaaccgtaacttatcat
ctgacaaatgagaatgaggtcgttatctcctatcaagcctctacggacaaacctacggtc
ttgaatctaaccaatcattcttattttaacctatccggtgcgggagacccttatatagga
gaccatattctcacgatcaacgccgactattatctgcctacagacaatacggcaatcccg
tacggacctaaagagaaggtagaaggtacaccgatggacttccggactcctcatgaggta
ggcgaacgaatcaatgacaatttcgaacagcttatattcggtaagggatatgaccacacg
tacatattaaataaagaggacaacgaactttcttactgcgctcgctgctcctcccccaag
accggtatcgtaatggaaacttatacgactcaaccgggcgtgcaattatacacaggtaac
tggatgactgggaatttcgaaggtaagaacggacaacgctacccggaacgggccgcttta
tgtctggaaacccaacatttccccgatagccccaacaaaccggaatatccgacaacggaa
ctccgcccgggcgaggttttccaaagtactactatttataaattcagtgtagaataa

DBGET integrated database retrieval system