KEGG   Parabacteroides distasonis: BDI_1726Help
Entry
BDI_1726          CDS       T00549                                 

Definition
(RefSeq) 1,4-alpha-glucan branching protein
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pdi  Parabacteroides distasonis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDI_1726
Enzymes [BR:pdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BDI_1726
Exosome [BR:pdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDI_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2039964..2041982)
Genome map
AA seq 672 aa AA seqDB search
MESLNLIKNDPWLAPYEAAIEGRYQYVIDKEKSLTNNGKLTLSEMASGYLYFGLHKTTKG
WVFREWAPNATAIYLIGTFNGWQKDNKYKLKRKANGIWEIALTDAQMCHEDLFKLLVEWD
GGSGERIPAWTRRVVQDEQSKIFSAQVWNPEKPYKFKNKRFKPKKSPLLIYECHIGMSTN
EEKVGTYNEFRQNILPRVAKDGYNAIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPDEL
KQLIDEAHGMGIAVIMDIVHSHAVKNEVEGLGRFDGSYDQYFLSGERREHPAWDSLCFNY
GKNEVLHFLLSNCKFWLEEYKFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGHQDGDAI
AYLTLANKLIHEVNPGAITIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKEK
KDEDWHPSSIWWETTNRRADEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKDDHNF
MVDRGIALHKMIRLVTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWNLVD
NLDLKYHFLGDFDREMLELIGDVKNFQDTPIQKVWDNDGDQILAYMRKDLVFVFNFSPTK
SFTDYGFLVPKGEYEVVLNTDATRFGGFGLADDTIRHFTQFDPLYKKEKKEWLKLYIPAR
SAVVLRKVKVKK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctaaatctgataaaaaatgacccgtggctggccccttatgaggcggctata
gaaggccggtatcaatacgtgattgataaagaaaagagcttgacgaataatggtaaacta
actttatccgagatggcttccggatatctttattttgggttacacaaaaccacgaaaggc
tgggtgttccgtgaatgggcgccgaatgctaccgctatttatttgatcggaacattcaac
ggatggcagaaagataataaatacaagcttaaacgtaaggcgaatggcatatgggagatc
gctttgaccgatgcgcagatgtgtcatgaggacttgtttaagttgctggtcgagtgggac
ggcggtagcggagaacgtattcccgcatggactcgccgggtggtgcaagatgagcaatct
aagatatttagcgctcaagtatggaacccggagaaaccttataaattcaagaataaacga
ttcaaacctaagaagtctccccttttgatctacgagtgccatatcggtatgagcactaac
gaggagaaggtggggacgtataatgaattccgtcaaaatatattgcctcgtgtagcgaag
gatggttataacgccattcagatcatggctatacaagaacatccttattatggatcgttc
ggctatcacgtaagtagcttcttcgctgcctcttcccgtttcggtacgccggacgagttg
aaacaactgatcgacgaggcgcacgggatgggtatcgccgtgatcatggacatcgtacat
agccacgccgtaaagaacgaggtggagggattaggccgctttgacggttcgtatgaccaa
tatttcctgagtggcgaacgccgtgagcatccggcatgggattccctgtgcttcaattat
ggaaagaacgaggtgcttcatttcttattgtcgaattgtaagttctggctggaggagtat
aagttcgatggtttccgtttcgacggcgtgacctccatgctttactacagccatggcttg
ggcgaggctttctgtaattacggcgattattttaatggccaccaagatggcgacgctatc
gcttatctaaccttggccaataaattgatccatgaggtgaatccgggcgctataacgatc
gccgaggaggtgagtggcatgccgggtttggcagccaaggtcgaagatggtggttatggc
tttgattatcgcatggccatgaacatcccggattattggatcaagacgatcaaggaaaag
aaggatgaggattggcatccgtcttcgatctggtgggagacgacgaaccgtcgtgccgat
gagaagacgatcagttatgccgagagccacgatcaagccttggtgggtgataagacgatc
atcttccgcttgatcgacgccgatatgtattggcatatgcaaaaagatgaccataatttc
atggtagatagaggtatcgccttgcataagatgatccgtttggttacggcttctaccatt
aatggcggttatctgaacttcatgggaaatgagtttgggcatccggagtggatcgacttc
ccaagggagggcaatggatggtcttataaatacgctcgccgccaatggaatttggtggac
aacttggatttgaagtaccatttcttgggcgatttcgaccgtgagatgttggaattgatc
ggggatgtgaagaatttccaagatacccctatccagaaggtttgggataatgatggcgat
cagatattggcttatatgcgtaaagacttggtttttgtgttcaactttagcccgacgaaa
tcgttcacggattacggtttcttggttccgaagggagaatatgaggtcgtattgaacact
gacgctacccgtttcggggggtttggcttggctgatgataccataaggcatttcacgcaa
tttgatccgttatataagaaagaaaagaaagaatggctgaaactttatatcccggcacgt
agcgccgtcgtattaaggaaagtgaaggtcaaaaagtaa

DBGET integrated database retrieval system