KEGG   Parabacteroides distasonis: BDI_1757Help
Entry
BDI_1757          CDS       T00549                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pdi  Parabacteroides distasonis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDI_1757
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BDI_1757
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BDI_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2086378..2087250
Genome map
AA seq 290 aa AA seqDB search
MEDKTSTLRLIYPQWQGGIVNHWMPDLPADDASRGYYLGAQLLNILAPPSPQKTVEVPIS
LDINDRETDLGISARKVILKQTKAALELLHENAPEKIITLGGECSVSVVPFTYLAAKYPD
DIAIVWIDAHPDINLPYDEYKGYHAMALTACLGMGDEEILQLLPGMFKVSNTLIVGLRSW
DEGMKERQKNLGIKGLSPEEVAKDSSSILKWLKGTGASKVVVHFDMDVIDPADMIAGVGV
EPNGMKIDEVVRVINNIASKYDLVGLTVAEPMPRIAIKLRNMLDRLPLLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaaacatcgacacttcgtttgatctatccccaatggcaaggtgggatcgtg
aatcattggatgcccgaccttcctgcggacgacgcttccagagggtattacctaggagct
caattactcaatatcctcgctcccccaagtccccagaaaaccgtggaagtacccatctca
ctagatataaacgatagagaaacggatctagggatcagcgcccgcaaggttattctgaaa
caaacaaaagcagccctcgaattactgcacgaaaacgctccagaaaagattatcacctta
gggggcgaatgttcggtaagtgtcgtacccttcacctatctggctgctaaatatccggat
gatatagccattgtctggatagacgcacatccggatataaacttgccgtatgacgagtat
aagggatatcatgcgatggcccttacggcctgtctagggatgggtgatgaagagattctt
caattattaccgggaatgttcaaggtctcgaataccttaatcgtaggtttacgctcgtgg
gatgagggcatgaaagaacggcagaagaacttaggtataaaaggtttatcaccagaggag
gtggcgaaggatagttcctccatcctcaagtggttaaaagggacgggcgcatccaaagtt
gtcgttcacttcgatatggacgtaatcgatccggcggatatgatagcgggagtcggcgta
gagcctaacgggatgaaaatagacgaggtcgtacgtgttatcaacaatatagcatccaag
tatgatctggtaggtcttacggtagccgagccgatgcctcgtatagccatcaagctaagg
aatatgctggaccggttacctttattgaaataa

DBGET integrated database retrieval system