KEGG   Parabacteroides distasonis: BDI_1787Help
Entry
BDI_1787          CDS       T00549                                 

Definition
beta-glycosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pdi  Parabacteroides distasonis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BDI_1787
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDI_1787
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BDI_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2133013..2134458)
Genome map
AA seq 481 aa AA seqDB search
MVLFSLLMVLICLNACSGAKISDNVTVYVTTNDRAKDFVRSEIALGDKQAASPCVITIDP
SVRYQTMDGFGAAVTGSTCYNLMRMAPEDRTAFLKETFSDTEGMGYSYIRISIGCSDFSL
SEYTCCDTKGVENFALQSEEKEYVIPILKEILAISPSIKILGSPWTCPRWMKVDNLKDLR
PFESWTSGQLNPAYYQDYATYFVKWIQAMEAEGIPIEAITPQNEPLNRGNSASLFMGWEE
QLSFVRDALGPKLKETGLKTKIYAFDHNYNYDNMLEQQGYPMKIYEDENAASFLTGAAYH
NYGGDREELNNVNGKFPDKELIFTETSIGMWNDGRNLEKRLMEDMEETALGTVNNWCKAV
IVWNLMLDNERGPNREGGCQTCYGAVDIDRSDYKTITRNSHYYIIGHLSSVVKPGAVRIG
SKGYTADGIMYSAFENLDGTEALVLLNNTDGTKNITVNSGERSFTYEVPAKAVASFRWNL
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggttctcttttctttattaatggtcttgatttgcttgaacgcatgttctggagcgaag
atctcggacaatgtaacggtgtatgtcacgacaaacgatcgtgcgaaagatttcgtgaga
agtgagatcgccttgggggacaaacaagccgcctcgccttgcgtgataacgatagaccct
tcggtgcgctatcagacgatggatggctttggtgccgccgtgacaggctctacctgctat
aacttgatgcggatggctcccgaggatcggacagctttcctgaaagagactttctctgat
acggaggggatggggtatagctatatccgtatctcgattggctgctcggacttttcttta
agtgagtatacttgttgtgacacgaagggtgtcgagaatttcgccttgcagagcgaggag
aaggagtatgtgataccgatcttgaaggagatcttggcgatcagcccttctataaaaatc
ttgggatcgccttggacttgtccaagatggatgaaggtggataacttaaaggatttgcgc
ccgttcgagtcgtggactagcggacagttgaatcccgcttattatcaagattacgctacc
tatttcgtgaaatggatacaggcgatggaggccgaggggattcctatcgaggcgataact
ccccaaaacgaacctttgaaccgaggaaattccgcttccttatttatgggatgggaggag
caactctctttcgtgcgtgacgctctaggccctaaactgaaagagactggcctcaagacg
aagatctacgctttcgaccataattacaattacgataatatgttggagcagcaaggctat
ccgatgaaaatctacgaggatgagaatgccgcttctttcctgacaggtgccgcttaccat
aattacgggggcgaccgggaggagttgaataacgtaaacggcaagttccccgataaagaa
ttaatatttacggaaacttctatcggcatgtggaatgatggacgtaacttagagaaacgc
ttgatggaagatatggaggagacggccttgggtacggtgaataactggtgtaaggcagtt
atcgtatggaacttgatgctggataacgagcggggaccgaaccgagagggtggttgccag
acttgttatggtgccgtggatatcgatcgctcggattataagacgattacccggaattct
cattattatattatcggtcatttatcctctgtggtgaagccgggggcagtacggatcggc
tctaaagggtatacggctgatgggattatgtattccgccttcgagaatttagatggaacg
gaagcgctcgtattactaaataatacggacgggactaaaaatataacggtaaacagtggc
gaacgttcgtttacctatgaggttcccgctaaagcagtcgcttctttccgttggaatctt
tactaa

DBGET integrated database retrieval system