KEGG   Parabacteroides distasonis: BDI_1816Help
Entry
BDI_1816          CDS       T00549                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BDI_1816
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BDI_1816
Exosome [BR:pdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDI_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2164569..2166068)
Genome map
AA seq 499 aa AA seqDB search
MNFRNKYVLAIDQGTTSSRAILFNHQGTIITLAQKPFQQYFPKPGWVEHDPNEIWYTQSS
VIKEAMAKADVTDSHIACIGIANQRETTIIWDRETGFPVYNAIVWQDRRTADYCEELKSQ
GWAERILQKTGLVIDAYFSATKIKWILDNVKGIRERAERGELCFGTVDTWLVWKLTRGAQ
FITDVTNASRTMLFNIRTLQWDQELLDLFTIPASMLPQVKACSEVYCETSTPIFKKGIPV
SGMAGDQQAALFGQLCVEDGMIKTTYGTGCFMILNTGKEPVLSQNNLLTTIAWKLGDQTT
YALEGSVFVGGAVVQWLRDGIGLIPNASITEQMAKSVSDNGGVYFVPALTGLGAPYWDQY
ARGAIIGITRGTTAAHLTRAALEGICYQVYDVLMAMENDIHAKPKEIRVDGGAIANNFLM
QFQSDICRCPVVRPNVLETTALGAAYLAGLAIGYWKDIDELKEQWCLDKVFNPQMKEDTA
RKLLNEWHKAVGRSQNWAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcgaaataaatatgtgttggcgatcgatcagggaaccactagctcccgggct
atcctgtttaatcatcaaggaactattattacgttggctcagaagccattccaacagtat
ttcccgaaaccgggctgggtagagcacgacccgaatgagatttggtacacccaatcgtct
gtcatcaaggaggcgatggcaaaagcggatgtcacggatagccatatcgcctgtatcgga
atcgctaaccaacgggagactaccatcatctgggaccgggagactggctttcccgtatac
aatgcgatcgtatggcaggatcgccgtacggcggattattgcgaggaacttaaatcccaa
ggctgggcggaacgtatcctgcagaagaccgggttggtgatcgacgcttatttctccgcc
acgaagataaaatggatattggataacgtaaagggtatccgggagcgtgcggagcgggga
gaactatgctttggaacggtagatacttggctggtttggaaacttacccggggcgctcaa
ttcattacggatgtgacgaacgcttcccgtaccatgcttttcaatatccgtactttgcaa
tgggaccaagagttattggacttgtttacaatacctgcctcgatgttaccgcaagtgaaa
gcctgtagcgaggtttactgcgagacatcaactcctatttttaagaaaggcattccggta
tccggtatggccggcgaccaacaggcggctctgttcggccagctctgcgtagaggatggt
atgatcaagacaacctacggaaccggctgctttatgatcctgaataccggtaaggaaccc
gttctttcccagaataacctattgacaacgatcgcatggaaattaggggatcagacgacc
tatgcgctggaaggtagtgtctttgtgggaggtgccgtcgttcaatggttgagggatggg
atcggcttgattccgaatgcctcgattacggagcaaatggcgaaatccgtcagtgataat
gggggcgtttattttgtgccggcgttaacaggcttgggtgcgccgtattgggatcaatac
gcacgtggcgctattatcgggattacccgcggaactacggcggcccacttgacccgtgcg
gctttggagggcatctgctatcaagtatatgatgtattgatggccatggaaaacgatatt
cacgccaagccgaaagagattcgggtagatggcggtgctatcgctaataacttcttgatg
caattccagtccgatatctgccgctgtccggtcgtacgtccgaatgtattggagacgact
gctttgggagccgcttatttggcgggcttggcgatcggctattggaaggatatcgatgaa
ctgaaagaacaatggtgcttggataaggtctttaacccacaaatgaaagaggataccgcc
cgtaaattattgaacgaatggcataaggcggtggggcgttctcagaattgggctgaataa

DBGET integrated database retrieval system