KEGG   Parabacteroides distasonis: BDI_1863Help
Entry
BDI_1863          CDS       T00549                                 

Definition
transcriptional regulator/glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_1863
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_1863
   00052 Galactose metabolism
    BDI_1863
   00500 Starch and sucrose metabolism
    BDI_1863
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_1863
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BDI_1863
   00524 Butirosin and neomycin biosynthesis
    BDI_1863
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BDI_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2215561..2216526
Genome map
AA seq 321 aa AA seqDB search
MESTKYYLGLDVGGTNMVAGVVDENHQIIAKESIPTQAGRTIEEITADMAEVSKKAVLKA
GLQMEDISSWGIGMPSYVNPKTNLLVHANCFGWKNVPIYDYLKKHISLPTYIANDANCAT
YGEVLAGSASQYTDAIMLTLGTGVGGGIIMGKRIYSGADNMGAELGHTKLVYNGERCTCG
QKGCLEAYCSSTALIRIMKEALQENKDTLIWKLCGEDENKVNGEILFEAAKQGDSLAKQI
VDDYISKLAAGISTFITIFRPQVIILGGGIAHAGDLLLKPLNEKLHTCTFAAEEIGIPQV
IRAELGNDAGIIGAALLEKTM
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaccaagtattatctcggtctggacgttggcggtaccaatatggtcgctggc
gtagtagatgagaatcaccagattatcgcaaaggagagtataccgacacaagccggacgc
acgatcgaggagatcaccgccgacatggcggaagtcagcaaaaaagcggttctcaaagca
ggcttgcaaatggaagacatctcttcttggggcatcggcatgcccagttacgtaaatcca
aagacgaaccttttggtacatgccaattgtttcggatggaagaatgtccccatctacgac
tatttaaagaagcatatttcattgcctacttatatagccaacgacgccaattgcgcaacc
tatggagaggtcttggccggatcggccagccaatataccgatgccatcatgttaacgcta
ggaacaggagtcggaggcggaattatcatgggtaagaggatttattccggagccgataat
atgggagcagagcttggacataccaaattggtatacaatggcgaacgttgcacatgcggg
caaaaaggctgtttggaagcttattgctcatctaccgcattaatccgcatcatgaaagag
gccttacaagagaataaggacaccttgatatggaaactttgcggcgaagacgaaaataaa
gtcaatggagaaatccttttcgaggccgctaaacaaggggattccctcgctaaacagatc
gtcgatgactatatcagtaaactggccgccggaatctccacgttcataaccatcttccgt
ccgcaagtaatcatcttagggggtggtatcgcacatgcaggtgacctgctgttgaaacct
ttaaacgagaaactacatacttgtaccttcgccgccgaggaaataggtatcccccaagtc
atccgtgcggaattaggaaatgacgccggaataatcggcgccgcgcttttagagaaaacg
atgtaa

DBGET integrated database retrieval system