KEGG   Parabacteroides distasonis: BDI_2011Help
Entry
BDI_2011          CDS       T00549                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pdi  Parabacteroides distasonis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BDI_2011
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     BDI_2011
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     BDI_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2380124..2380957
Genome map
AA seq 277 aa AA seqDB search
MIEIPESATIGKQASETLKGKRIAHVIESNSPHRFTFYNGDPAEYSNRLVGRTVLGAQGY
GAFVDIFMDADTHLLIGDGTNMRYYTSAEKAPKKYQLMIVFEDDSFLAFTVSMYGSIYAF
KGEFDNPYYQGSIHKLCPLDERFDKTYFISLIGNLKKDISAKALLATEQRIPGLGNGVCQ
DILFNARISPKRKISTLSEEDIDRLFNTVKSTLEEMTRRGGRDTEKDLYGALGNYRTILS
KNTYHDPCPVCGERIQKEAYLGGSIYYCPHCQPSAAN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattgagattcccgaatccgccaccattggcaaacaggctagcgaaacgctaaagggt
aaacggatagcgcatgttatcgagtcgaacagtcctcaccgcttcacgttctataatggc
gatccggcggaatactccaataggctggtaggacgaacggtcctaggcgcccaaggctat
ggcgcattcgtggacatctttatggacgcagatacccacctcttaatcggagacggaacc
aatatgcgttattatacctccgcagaaaaggccccgaagaaatatcagcttatgatcgta
ttcgaggacgattcgttcctagctttcacggtttcgatgtatggttccatctacgctttc
aaaggcgagtttgacaatccctattaccaaggtagcatccataagctatgtccgttggac
gagagattcgataaaacctattttatcagtctcatcgggaatctcaagaaagatatatcc
gcaaaggcgttactcgccaccgagcaacgtattccgggcctgggcaacggagtctgccaa
gatatcttgttcaatgcccggatctccccgaaacgaaaaatatcgactttatcagaagag
gatatagaccgcctcttcaacaccgtgaaatccacgctggaagagatgactcgccgagga
ggccgggatacggagaaggatctatacggcgccttaggcaattaccgcacgatcctatcg
aagaacacctaccatgacccttgccccgtctgtggcgaacggatacagaaagaggcttac
ctcggaggcagcatttactattgcccgcattgccagcctagtgcggcaaattaa

DBGET integrated database retrieval system