KEGG   Parabacteroides distasonis: BDI_2255Help
Entry
BDI_2255          CDS       T00549                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00010  Glycolysis / Gluconeogenesis
pdi00620  Pyruvate metabolism
pdi00640  Propanoate metabolism
pdi00680  Methane metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
pdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_2255
   00620 Pyruvate metabolism
    BDI_2255
   00640 Propanoate metabolism
    BDI_2255
  Energy metabolism
   00680 Methane metabolism
    BDI_2255
Enzymes [BR:pdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BDI_2255
Lipid biosynthesis proteins [BR:pdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BDI_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABR43986
UniProt: A6LE72
Position
2645256..2646911
Genome map
AA seq 551 aa AA seqDB search
MLERFIDKTTFESQEDFIKNFKIKVPENFNFGYDVVDAWAEEEPDKKALCWTNDHGEHID
FTFADLKRYTDQTASYFQSLGIGHGDMVMLILKRRYEFWFSIIALHKLGAVVIPATHLLT
KKDIVYRANAADIKMIVCAGEEVITKHIIEALPDSPTVKSVVSVGPEIPEGFEDFQQGIQ
NAAPFVRPSHPNSNDDISLMYFTSGTTGNPKMVAHDFTYPLGHIVTGSFWHNLHKDSLHL
TIADTGWGKAVWGKLYGQWIAGATVFVYDHEKFTPADMLQMIQDYRITSLCAPPTIFRFL
IREDMTKYDLSSLQYCTIAGEALNPAVFDTFYKLTGIKLMEGFGQTETTLTVATFPWMEP
KPGSMGVPNPQYDVDLLRPDGSRAEDGEQGQIVIHTTNGKPIGLFKEYYRDAERTREAWH
DGLYYTGDVAWRDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKDYKDKAGDALVKELQNHVKRVTAPYKYPRVVEFVDELPKTISGKI
RRVEIRDKDNK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagatttatagataaaacgacgtttgagtcgcaagaagattttattaaaaac
ttcaagatcaaggttccggagaacttcaacttcggatatgatgtggtagacgcttgggcg
gaggaagaacctgataagaaagcgttatgttggacaaacgatcatggagagcatattgat
tttacgtttgccgacttgaaacggtatacggaccagacggcttcttatttccaatccttg
gggatcggacatggcgatatggtgatgctgatactcaaacgccgttatgagttctggttc
tctatcatcgcattgcataaattaggggctgtcgtgataccggctacacacttactgacc
aagaaagatatcgtttatcgtgcgaatgccgccgatatcaagatgatcgtttgcgccgga
gaggaagtgataacgaaacatatcatagaggctttgccggactcaccgaccgtaaaaagt
gttgtatccgtagggccggaaataccggaaggtttcgaggatttccaacagggtatccaa
aacgccgctcctttcgtccgcccgtctcacccaaatagcaatgacgatatctctttgatg
tatttcacctccggtacgactggaaacccgaaaatggtggcccacgactttacgtatccg
ctggggcatatcgtgaccggtagtttctggcacaacttgcataaggacagccttcacctg
acgatcgcagatacgggctggggcaaggcagtttggggtaagctatatgggcaatggatc
gccggagcgaccgtatttgtttacgaccacgagaaattcacgcctgctgatatgttgcag
atgatacaggattaccggatcacctcgctttgcgctcctcctacgatcttccgtttctta
attcgtgaggatatgactaaatacgatttatcatctttacaatattgtacgatcgccggc
gaggccttgaaccccgccgtgttcgacacgttctataagttgaccggcattaaattgatg
gaaggcttcggccagacagagactacgctgacagtcgccactttcccgtggatggagccg
aaaccgggctctatgggtgttcccaacccgcagtacgatgtcgatttattgcgtccggac
ggaagccgtgcggaggatggcgagcaaggacagatcgtgatccacacaacaaatggcaag
cctatcgggttattcaaggaatattaccgggacgcagaacgtacccgggaagcttggcac
gatggcctgtattacacgggagacgtggcttggcgtgacgaggatggttacttatggttc
gttggccgcgcggacgacgtgatcaagagttccggctatcgtatcgggccgttcgaggtg
gaaagtgccttgatgactcaccctgcggtagtggaatgtgctatcaccggtgtccccgac
gagatccgcggacaggtagtaaaggccacgatcgtattggcgaaggattataaggataaa
gcgggtgatgccttggtcaaagaattgcaaaatcacgtgaaacgtgtcaccgctccttac
aaatatccccgtgttgtcgaattcgtggacgaactgccgaaaacaatcagcggaaagatc
cgacgggtagagatccgggataaagataataaataa

DBGET integrated database retrieval system