KEGG   Parabacteroides distasonis: BDI_2255Help
Entry
BDI_2255          CDS       T00549                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pdi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pdi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pdi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pdi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2645256..2646911
Genome map
AA seq 551 aa AA seqDB search
MLERFIDKTTFESQEDFIKNFKIKVPENFNFGYDVVDAWAEEEPDKKALCWTNDHGEHID
FTFADLKRYTDQTASYFQSLGIGHGDMVMLILKRRYEFWFSIIALHKLGAVVIPATHLLT
KKDIVYRANAADIKMIVCAGEEVITKHIIEALPDSPTVKSVVSVGPEIPEGFEDFQQGIQ
NAAPFVRPSHPNSNDDISLMYFTSGTTGNPKMVAHDFTYPLGHIVTGSFWHNLHKDSLHL
TIADTGWGKAVWGKLYGQWIAGATVFVYDHEKFTPADMLQMIQDYRITSLCAPPTIFRFL
IREDMTKYDLSSLQYCTIAGEALNPAVFDTFYKLTGIKLMEGFGQTETTLTVATFPWMEP
KPGSMGVPNPQYDVDLLRPDGSRAEDGEQGQIVIHTTNGKPIGLFKEYYRDAERTREAWH
DGLYYTGDVAWRDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKDYKDKAGDALVKELQNHVKRVTAPYKYPRVVEFVDELPKTISGKI
RRVEIRDKDNK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagatttatagataaaacgacgtttgagtcgcaagaagattttattaaaaac
ttcaagatcaaggttccggagaacttcaacttcggatatgatgtggtagacgcttgggcg
gaggaagaacctgataagaaagcgttatgttggacaaacgatcatggagagcatattgat
tttacgtttgccgacttgaaacggtatacggaccagacggcttcttatttccaatccttg
gggatcggacatggcgatatggtgatgctgatactcaaacgccgttatgagttctggttc
tctatcatcgcattgcataaattaggggctgtcgtgataccggctacacacttactgacc
aagaaagatatcgtttatcgtgcgaatgccgccgatatcaagatgatcgtttgcgccgga
gaggaagtgataacgaaacatatcatagaggctttgccggactcaccgaccgtaaaaagt
gttgtatccgtagggccggaaataccggaaggtttcgaggatttccaacagggtatccaa
aacgccgctcctttcgtccgcccgtctcacccaaatagcaatgacgatatctctttgatg
tatttcacctccggtacgactggaaacccgaaaatggtggcccacgactttacgtatccg
ctggggcatatcgtgaccggtagtttctggcacaacttgcataaggacagccttcacctg
acgatcgcagatacgggctggggcaaggcagtttggggtaagctatatgggcaatggatc
gccggagcgaccgtatttgtttacgaccacgagaaattcacgcctgctgatatgttgcag
atgatacaggattaccggatcacctcgctttgcgctcctcctacgatcttccgtttctta
attcgtgaggatatgactaaatacgatttatcatctttacaatattgtacgatcgccggc
gaggccttgaaccccgccgtgttcgacacgttctataagttgaccggcattaaattgatg
gaaggcttcggccagacagagactacgctgacagtcgccactttcccgtggatggagccg
aaaccgggctctatgggtgttcccaacccgcagtacgatgtcgatttattgcgtccggac
ggaagccgtgcggaggatggcgagcaaggacagatcgtgatccacacaacaaatggcaag
cctatcgggttattcaaggaatattaccgggacgcagaacgtacccgggaagcttggcac
gatggcctgtattacacgggagacgtggcttggcgtgacgaggatggttacttatggttc
gttggccgcgcggacgacgtgatcaagagttccggctatcgtatcgggccgttcgaggtg
gaaagtgccttgatgactcaccctgcggtagtggaatgtgctatcaccggtgtccccgac
gagatccgcggacaggtagtaaaggccacgatcgtattggcgaaggattataaggataaa
gcgggtgatgccttggtcaaagaattgcaaaatcacgtgaaacgtgtcaccgctccttac
aaatatccccgtgttgtcgaattcgtggacgaactgccgaaaacaatcagcggaaagatc
cgacgggtagagatccgggataaagataataaataa

DBGET integrated database retrieval system