KEGG   Parabacteroides distasonis: BDI_2256Help
Entry
BDI_2256          CDS       T00549                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pdi  Parabacteroides distasonis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDI_2256
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BDI_2256
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BDI_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2646927..2648000
Genome map
AA seq 357 aa AA seqDB search
MKRIAVKIGSNVLTRKDGTLDITRMSALVDQVADLHRQGMEIVLISSGAVASGRSEIKAG
KKLDPVSARQLYSAVGQAKLINRYYELFREHGMTCGQVLTTKENFGSRTHYLNQKHCMEV
MLENKVIPIVNENDTISVTELMFTDNDELSGLIATMMGMDALVILSNIDGIYNGNPSDPD
SSVIREIECGKTDLSEYVQTSKSSFGRGGMLTKCHIAQKVADEGIAVIIANGKKDNILPM
LLAVDSDTVCTRFIPASKPVSSVKKWIAHSEGFAKGEIHINKGAEEALTAPKATSVLLVG
VTRIEGDFEKDDIVKIMNEEGVQIGVGCTAYDSEEARKQIGQRDLKPLIHYDYLYLD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggatcgctgtaaaaataggaagcaatgtcctgacccgcaaggatgggacgcta
gatatcacccgcatgtccgcgttggttgaccaagtagcggacttgcaccggcaaggtatg
gagatcgtcttgatctcctccggtgccgtggcttctggacgaagcgagataaaagccggc
aaaaagctggatcccgtatcagcccggcaactgtattcggcggtaggacaggccaagttg
atcaaccggtattacgagttattccgggagcatggcatgacttgcgggcaagtgcttact
acaaaagagaatttcgggagtcgtacgcattacctgaaccagaagcattgcatggaggta
atgcttgaaaacaaggtgatccccatcgtaaatgagaatgatacgatatccgtaaccgag
ctgatgttcacggataatgatgagttatccggcttgatcgctacgatgatgggaatggat
gccttggtgattctcagtaatatagacgggatttacaatggaaatccgtcggacccggat
agttccgtgatccgggaaatcgaatgtgggaaaacagatttgtcggaatatgtacagact
agcaaatcatcctttggacggggaggtatgttgacgaaatgtcatatcgcccaaaaagtg
gcggacgaaggtattgcggttatcatcgccaacggcaaaaaggataatatccttccgatg
ttattggcggtggatagcgacacggtctgcacccgtttcattccggcctcgaaacccgtc
agcagcgtaaagaaatggatcgcccactccgagggtttcgccaaaggggaaatacatatc
aataaaggagccgaggaggcattgaccgccccgaaagcgactagcgtattattggttgga
gtaacccgcatcgagggtgatttcgaaaaagatgatatcgtaaagataatgaatgaggaa
ggcgtgcaaatcggcgtaggctgtaccgcctatgacagcgaggaagcacgtaagcaaata
gggcaacgggatttaaaaccgcttatacattatgattatctatatctggattaa

DBGET integrated database retrieval system