KEGG   Parabacteroides distasonis: BDI_2351Help
Entry
BDI_2351          CDS       T00549                                 

Gene name
eno
Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_2351 (eno)
   01230 Biosynthesis of amino acids
    BDI_2351 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_2351 (eno)
  Energy metabolism
   00680 Methane metabolism
    BDI_2351 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BDI_2351 (eno)
Enzymes [BR:pdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BDI_2351 (eno)
Exosome [BR:pdi04147]
 Exosomal proteins
  Proteins found in most exosomes
   BDI_2351 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773484..2774767)
Genome map
AA seq 427 aa AA seqDB search
MEIVKVVGREILDSRGNPTVEVDVHLASGAFGRAAVPSGASTGENEAIELRDGDKNRYGG
KGVLRAVDNVNKVIAPAILGMSALNQREIDHKLLDLDGTKTKSNLGANAMLGVSLAVAKA
AANYLDLPLYRYIGGTNTYVLPVPMMNIINGGSHSDAPIAFQEFMIRPVGAKSFREGLRM
GAEVFHALKKVLHDRGLSTAVGDEGGFAPALDGTEDALNSIMAAIKAAGYEPGKDVTIAM
DCAASEFYHDGVYDYTKFEGEKGAKRNAQQQVAYLSELVNKYPIDSIEDGMDENDWAGWQ
MLTSTLGGKCQLVGDDLFVTNVEFLKKGIEKGCANSILIKVNQIGTLSETLDAIEMAHRN
GYTSVTSHRSGETEDATIADIAVATNSGQIKTGSLSRSDRMAKYNQLLRIEEELGSLAVY
GYKTYKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgtaaaagtagtaggtagagagatccttgattcacgtggtaacccgacagta
gaagtagacgtacatttggcttccggcgcattcggtcgtgcggctgtaccttctggcgcc
tctaccggtgagaacgaggctatcgagttacgcgatggcgataagaatcgctacggtggc
aaaggcgttctccgtgccgtggataatgtaaataaggtaatcgctcccgccattttagga
atgagcgccttgaatcaaagagagatagaccataagttgctggatttggatggtacaaag
acaaaatcaaatctaggagctaacgctatgttaggtgtatcgcttgccgtagcgaaggca
gcggctaattatctggatctgcctttatatcgttatatcggtggaacaaatacctacgtg
ttgccggttcctatgatgaacattatcaatggaggttctcactccgacgctccgatcgct
tttcaggaattcatgattcgtccggtaggtgcgaagagtttccgtgaggggcttcgtatg
ggcgcagaggttttccatgcgttgaagaaagtattgcacgatcgtggcttgagcacggct
gtaggtgatgagggcggtttcgctccggcattggatggtacggaagatgccttgaattct
attatggccgctatcaaagccgctggatatgagccgggcaaggatgtgacgatagccatg
gattgcgctgcttccgagttttatcacgatggtgtgtatgattatacgaaattcgagggt
gagaaaggcgctaagcgtaacgcccagcaacaagtcgcttatctgagtgagttggtgaac
aaatacccgattgattctatcgaggatggtatggacgagaatgactgggccggttggcaa
atgctaacctccacgctaggcggaaaatgccagttggtaggtgatgacctattcgttaca
aacgtagagttcttgaagaaaggtatcgagaagggttgcgcaaactccatcttgatcaag
gtaaaccagatcggtacattgagcgagacattagacgctatcgagatggcccaccgtaat
ggctatacatccgtgacttcccaccgttccggtgagacagaggacgctacgatcgccgat
atcgccgtagctaccaacagcggacagatcaagaccggctcattgagccgttccgatcgt
atggcgaaatacaaccagttgcttcgtatcgaagaggaattgggttccttagctgtttat
ggttataagacttataagaagtaa

DBGET integrated database retrieval system