KEGG   Parabacteroides distasonis: BDI_2629Help
Entry
BDI_2629          CDS       T00549                                 

Definition
(RefSeq) hypothetical protein
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_2629
   01230 Biosynthesis of amino acids
    BDI_2629
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_2629
  Energy metabolism
   00680 Methane metabolism
    BDI_2629
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_2629
Enzymes [BR:pdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     BDI_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3107562..3108257)
Genome map
AA seq 231 aa AA seqDB search
MEKCRKLVIVRHGNTFRAGETPTRVGARTDLPLVEEERARSAGRYLREKGIVIDKVISAP
LKRTLETANYILEEMNVDLPIIQDLRLKEIDYGPDENMVEDHVIKRLGSLYLEKEGMDRK
DLTEDRIVESGLSVIAQWNEKAVVPLGWNVDVEKLISGWQDLAASIPDGETWLLVSSNGV
MRFSPYILGNYEDFCATHDIKVPTGGVCIFDCVGDHWRCTDWGIKAYKLFK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatgtagaaaacttgtgatcgtacggcatggtaatacgtttcgtgcgggagag
actccgactcgggttggagctagaactgatttgcctctggtagaggaggaacgagctaga
tctgcgggacgttatttacgtgaaaaggggattgtgatcgacaaggtgatttcggccccc
ttaaaacgcacattggagaccgctaactatatcttggaggaaatgaatgtggatttgcct
atcattcaagacttacgtcttaaagagattgattatgggccggatgagaatatggtagaa
gatcatgtaataaaacgtttgggatctctctatttagaaaaggagggaatggaccggaaa
gacctaacggaagatcggatcgtggagagtggactttccgtgatcgcccaatggaatgag
aaggccgtggtaccgttaggatggaacgtagatgtagagaaactgataagcggttggcag
gatttggcggctagtatacctgatggtgagacttggctgctagtatcttccaatggagtg
atgcgtttctccccctatattctggggaattatgaggatttctgtgcgactcatgatatt
aaggttccgacaggtggggtttgtatattcgattgtgtgggtgatcattggaggtgtacg
gattggggaataaaggcttataaactttttaaatga

DBGET integrated database retrieval system