KEGG   Parabacteroides distasonis: BDI_2672Help
Entry
BDI_2672          CDS       T00549                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00220  Arginine biosynthesis
pdi00330  Arginine and proline metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01130  Biosynthesis of antibiotics
pdi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BDI_2672
   00330 Arginine and proline metabolism
    BDI_2672
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BDI_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABR44391
UniProt: A6LFC7
Position
complement(3173392..3174288)
Genome map
AA seq 298 aa AA seqDB search
MKINVIGVPLNLGCDRAGVERAPNHLRERGLMGVIRKNGHKAFDLGNLYVPPVSEADKFV
RGNSMKYLDAIVEVNTNLAELVYDTLRGGAFPLVIGGDHSLGLGSASGVGKCYDDFGIIW
LDAHGDINTSETSPSGNIHGMPLSALMGMGSEELVNIYAPGNKVNPQNVFLVGTRSLDEG
EWDLIEREKLSVYTMETIHLKGIGFVAEDIKRKLKERKIRNVHFSIDVDSIDPRFAPGTG
TRVCEGLMPDEFNNFVDHMLSTNLVKSMDLVELNPELDVNEQTTNLCLQIIDYITARL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaatgtaataggtgttcccttgaatctgggatgtgaccgggctggcgtagag
cgtgccccgaaccaccttcgggaacggggattgatgggggtgatccggaagaacgggcat
aaagcctttgacttgggtaatttgtatgtaccccctgttagcgaggcggataagttcgta
cggggtaacagcatgaaatatctggatgcgatcgtggaggtaaatacgaatctggcggag
ttggtttatgatacattgcgtggaggagcgttccccttggtgattggcggggatcattcg
ctgggtttaggtagcgcctcgggcgtgggtaaatgttatgatgatttcggtattatctgg
ctggacgctcatggggatatcaataccagcgagacttctcccagtggtaatatccacggg
atgcctttgagtgcgttgatggggatgggaagcgaggaactggtgaatatctacgctccc
gggaataaggtgaatccgcagaacgtattcttggtcgggacccgcagtctggatgagggc
gagtgggatttgatcgagcgggagaagctgagtgtctatacgatggagacgatccatctg
aaaggcatcggcttcgtagctgaggatatcaagcggaaattgaaggaacggaagatccgc
aacgtgcatttcagcatagacgtggatagcatagacccccgtttcgctccgggcacggga
acccgtgtgtgtgagggactgatgccggatgagtttaataacttcgtggatcatatgttg
tctacgaatctggttaagtcgatggatttggtagagctgaatccggagctggacgtgaac
gagcagaccacaaacctttgtctgcagatcatcgattatattaccgcccgtctataa

DBGET integrated database retrieval system