KEGG   Parabacteroides distasonis: BDI_2693Help
Entry
BDI_2693          CDS       T00549                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00790  Folate biosynthesis
pdi01100  Metabolic pathways
Module
pdi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BDI_2693
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BDI_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF3638 QueF
Motif
Other DBs
NCBI-ProteinID: ABR44412
UniProt: A6LFE8
Position
complement(3200763..3201353)
Genome map
AA seq 196 aa AA seqDB search
MSEVNEETLRAREALAGHYKEVLGLLGEDVEREGLLKTPERVAKAMQFLTKGYHEDPEAV
LRSAMFQEEDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIF
ARRLQIQERMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQ
QAKTREEFMNLIKHNR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtaaacgaagagacgctacgtgcccgggaagctttggccggccattataag
gaagtattgggtttgctgggtgaggacgtggagcgtgagggtctgcttaaaacgccggaa
cgtgtagcgaaagcgatgcagtttttaaccaagggataccatgaggatccggaggcggta
ctccgttccgccatgtttcaggaagaggattacaaacagatggttatcgtgaaagatatc
gatttcttctccctttgtgagcatcatatgttgcctttctttggcaaggcccacgtggct
tatatccccaagaaatatattacgggcttaagcaagatccctagggtagtggatatcttc
gcccgccgccttcagatacaggagcgtatgacgatgcagatcaaggattgcatccagagg
accttggacccgttgggcgtgatggtcgtgatcgaggcgcagcatatgtgtatgcagatg
cgtggcgtggagaaacaaaattccttgacgactacctctgatttcacaggctttttccaa
caagctaagacgcgcgaggagtttatgaatctgatcaagcataaccgctga

DBGET integrated database retrieval system