KEGG   Parabacteroides distasonis: BDI_2809Help
Entry
BDI_2809          CDS       T00549                                 

Definition
shikimate kinase
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
pdi  Parabacteroides distasonis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pdi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pdi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3351854..3352375)
Genome map
AA seq 173 aa AA seqDB search
MKRVFLVGYMGAGKTTVGKELAKLAGLSFIDLDYYIEGRYHKAVSQIFAERGEEAFREIE
RNMLHEVAEFEDVLISTGGGAPCFFDNMEFMNASGTTVYLKVSVEELAKRLELCKHTRPV
LKGRSGEELRAFIAESLEKRNPFYTKASITFDAEKMLTESDVHDISNALMKIL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtttttttggtcggatatatgggagcgggcaagacaacggtgggaaaagag
cttgccaagctcgccggtctttcgttcatagatcttgattactatatcgaagggcgttat
cataaggccgtttcgcagatattcgccgagagaggggaggaggctttccgagagatagaa
cggaatatgcttcacgaggtcgctgagtttgaggacgtgctgatctccacgggaggaggc
gctccttgctttttcgataacatggagtttatgaacgcttctggcacgacggtttacttg
aaggtgtcagtcgaggagctggcgaagcgtctggagttgtgcaaacatacccgtccggtg
ttgaaaggacgttccggggaggaactgagggcgtttatcgccgagagtctggagaaaagg
aatccgttttatacgaaggcgtccataacgtttgatgccgagaagatgttaacagaatct
gatgtacatgacatatcgaacgcgttaatgaaaatcctatag

DBGET integrated database retrieval system