KEGG   Parabacteroides distasonis: BDI_2891Help
Entry
BDI_2891          CDS       T00549                                 

Definition
hypothetical protein
Organism
pdi  Parabacteroides distasonis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3451176..3451904
Genome map
AA seq 242 aa AA seqDB search
MKWHDLLYFSKGERQALTLLLSLIAMAWIAIIGTDFYRSQFQTVPLVNTGIKQDSSQIYS
NKTPSNSIRKEKESHSNETKIPSEGKSKRIRRESKPHFPSYPKAEKWPQGTVVELNSADT
TALKMVPGIGSVFAKRIIKYRDLLGGFYSVEQLGEVYGIDEDRYEAMKSWFSVDPSVISH
LFVNQLSAKKLASHPYVSYKQARIIEKMIRKKGKLQGWEDLSLLEEFPEHEQQRLRYYLS
FH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggcatgatttactttatttctccaagggggaaaggcaggctcttaccctactc
ctttccttaatagcgatggcatggatcgcaattatcgggacggatttctaccgttcccaa
tttcaaacagttccattggtaaacaccggaatcaaacaagattcctcacagatctattcg
aataaaacaccttcaaattccattcggaaagaaaaagaatcccattcgaacgaaactaaa
atcccttccgaagggaaatccaaacgcatccgaagggaatcaaagccccattttccctct
tatcccaaagcagaaaaatggccgcaaggaacggttgtcgaattaaactcggctgatacc
accgcccttaaaatggttccgggaattggtagcgtttttgccaagcggatcattaaatac
agggacttattaggaggattttattccgtagaacaactaggagaagtatatggtattgac
gaggatcgttatgaagcgatgaaatcgtggttttccgtggacccgtcagttattagtcat
ctatttgtcaaccaactgtcagctaaaaaactagccagtcacccatatgtcagttataaa
caagctaggatcatcgaaaaaatgatccggaaaaaagggaaattacaaggttgggaggat
ttatccctattggaagagtttccggagcacgaacaacaacgattacgatattatctttca
ttccattga

DBGET integrated database retrieval system