KEGG   Parabacteroides distasonis: BDI_3589Help
Entry
BDI_3589          CDS       T00549                                 

Definition
transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_3589
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_3589
   00052 Galactose metabolism
    BDI_3589
   00500 Starch and sucrose metabolism
    BDI_3589
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_3589
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BDI_3589
   00524 Butirosin and neomycin biosynthesis
    BDI_3589
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BDI_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4396812..4397798
Genome map
AA seq 328 aa AA seqDB search
MEKPYVVGIDIGGTNTVFGVVDARGTILYSGSIKTGKYADVNDYVAELAKGLKSVIDQAG
GPDKIKGVGVGAPNGNFFNGCIEFAPNLPWKGKIPLAQLISEQIDGIPVALTNDANAAAI
GEMTYGAARGMKDFIVITLGTGVGSGIVVGGNLVYGHDGFAGELGHVIMRRNNGRQCGCG
RQGCLEAYASATGVARTAREYLEIRKDESVLRDLDPDEITSKDVYDAAMKNDKIALEIFE
ATGSMLGEAFADFVAFSSPEAIILFGGLTKAGDLIMNPIKRSMEKNMLKVYAGKTKLLFS
QLKESDAAVLGASALGWEVRDQSAGLEV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccttatgtagtaggtatcgatataggtggtaccaacactgtttttggtgta
gttgacgcaagaggaacaatcttgtatagtggatcaattaagactggtaaatatgcagac
gttaatgactatgtagcggaattagctaaaggtctgaagtctgttattgatcaggctggt
ggtccggataagattaaaggtgtgggtgtaggtgctccgaacggaaactttttcaacgga
tgtatcgaattcgctccgaacttgccttggaaaggtaagattcctttggctcaattgatc
agcgaacagattgatggtattcctgttgctttaacaaacgacgccaatgctgccgctatc
ggtgagatgacttatggagccgctcgcggtatgaaagattttatcgtgatcactttgggt
accggcgtgggtagcggtatcgtagtaggtggtaacttggtatacggacatgacggtttt
gccggtgagttgggccatgttatcatgcgtcgtaacaacggtcgtcagtgtggttgcggt
cgtcaaggatgtctggaggcttatgcttcagctaccggtgtggctcgtacggctcgtgaa
tatctggaaatccgtaaggacgagagtgttcttcgcgacttggatccggatgaaatcact
tcaaaagacgtatacgacgcagctatgaagaatgataagatcgctcttgagattttcgag
gctaccggctctatgttgggagaggctttcgctgatttcgtagcattctctagcccggag
gctatcattttgtttggcggtcttacgaaagctggcgatttgatcatgaacccgattaaa
cgttcaatggagaaaaatatgttgaaggtttacgcaggtaagactaaattattattctct
caattgaaagagagcgacgctgccgtattaggagcaagtgctttgggttgggaagtaaga
gaccaaagcgctggtttggaagtctaa

DBGET integrated database retrieval system