KEGG   Parabacteroides distasonis: BDI_3671Help
Entry
BDI_3671          CDS       T00549                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00010  Glycolysis / Gluconeogenesis
pdi00030  Pentose phosphate pathway
pdi00051  Fructose and mannose metabolism
pdi00680  Methane metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
pdi01200  Carbon metabolism
Module
pdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_3671
   00030 Pentose phosphate pathway
    BDI_3671
   00051 Fructose and mannose metabolism
    BDI_3671
  Energy metabolism
   00680 Methane metabolism
    BDI_3671
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BDI_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABR45366
UniProt: A6LI52
Position
4486342..4488342
Genome map
AA seq 666 aa AA seqDB search
MTKDIIAESVQNDLRYLQLLARSFPTIADASTEIINLEAILNLPKGTEHFLSDLHGEDQA
FSHVLRNASGAVKRKVNEIFSNTLRESEKKELCSLIYYPEDKLELIKSQEQDLEDWYQVT
LNQLVRVCRNVSSKYTRSKVRKALPKEFSYIIQELLHESSVEPNKSAYVDQIICTIISTG
RADDFIIAMCNLIQRLTIDLLHIIGDIYDRGPGAHLIMDILCDYHNFDVQWGNHDILWMG
AASGNLVSIANVIRMCLRFGNMATLEDGYGINLLPLATFAMEAYGDDPCALFMPKTKFAD
NAMDEKTTRLIAQMHKAITIIQFKLEGEIIRRRPEFEMDDRMLLHHIDLKRGVVHIDGKD
YTLKDTNWPTLDPKDPYRLSIEEEDLIRKILHSFESSEKMKKHMRCFFRHGGMYQVCNSN
LLFHASIPMNPDGTFKSVRILGQDYKGRALLDRVDQLIRTAYFKTGEQEEVEYAHDYIWY
LWGGKDSPLFDKSKMATFERAFIEEAETHKEEKGAYYTLREQEEICDKILDEFGVTGMHR
HIINGHVPVRSNQGENPIKANGKMLVIDGGFSRPYHLETGIAGYTLVYHSRGFQLVQHEP
FESRAKAIEEGLDIKSTTIVVELSSHRQMVKDTDKGADLQSQIKDLEKLLYAYRNGLIKE
KERMER
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagatattatagccgaatctgtacaaaacgatttacggtatttgcaattgttg
gcacggagtttcccgacgatcgcggatgccagtacggagatcattaatctggaggcgatc
ttgaacctaccgaagggtacggagcacttcttgagtgatttgcatggcgaggatcaagcc
tttagccatgtgctgagaaacgcttccggtgccgtaaagcgcaaggtgaacgagattttc
agtaatacgctccgggaatccgagaagaaggagctttgttccttgatttattatccggag
gataagctggaactgatcaagagccaagagcaagatctggaagattggtatcaagttacc
ttgaatcaattggtacgtgtttgccggaacgtgtcctccaaatacacccgttcgaaagta
cgtaaggctttacccaaggagttctcctatattattcaggagttattgcacgagtcttcc
gtagagccgaataaatccgcttatgtggatcagattatttgtacgatcatctccacggga
cgtgcggacgatttcattatcgctatgtgtaacttgatccaacggttgacaatcgacctg
ttacatatcatcggcgatatttacgatcggggtccgggcgctcatctgatcatggatatc
ctttgcgattaccataatttcgatgttcaatggggtaatcatgatatcttgtggatggga
gccgcttccggtaatttggtaagtatcgccaacgtgattcgtatgtgtttacgctttggt
aatatggctaccttagaagatggatatggtatcaatcttttgccgttggccactttcgcg
atggaggcgtatggggatgatccttgcgcgttattcatgccgaaaacaaagttcgccgat
aatgcaatggatgagaagaccacccgtttgatcgcccagatgcacaaggcgatcaccatc
atccagttcaagctggagggtgagatcatccgccgtcgtccggagtttgagatggatgac
cggatgttgttgcaccatatcgatctgaagcggggagtggttcatatcgatggaaaggat
tatacgcttaaagatactaactggcctactttagacccgaaagatccgtatcgtctttct
attgaggaagaggatttgatccgaaagatattgcattcttttgagagcagcgagaagatg
aaaaagcatatgcgttgtttcttccggcatgggggaatgtatcaggtttgtaattccaat
ttactgtttcatgcctctatcccgatgaatccggatggtacatttaagtcagtacgtatc
ttggggcaggattataagggccgtgctttgttggaccgtgtagaccaactgatccgtacg
gcttatttcaagaccggggaacaggaagaagtggaatatgcgcatgattatatctggtat
ctttggggcggcaaggactccccgttattcgataaaagcaagatggctactttcgagcgt
gcctttatcgaagaggccgagactcataaggaggaaaaaggcgcttattatacgttacga
gagcaagaggaaatttgtgataagatattggatgagtttggggtgaccggtatgcatcgg
catatcatcaacggacatgtccctgtccgttccaatcaaggtgagaatcccattaaggcg
aatggcaagatgttggtaatcgatggcggtttctcccgtccgtatcatttggaaaccggt
atcgcgggctatacattagtatatcactcccgtggtttccagcttgtgcaacacgaaccc
ttcgaatcccgggcgaaagcgatcgaggaaggcttggatatcaaatccaccacgatcgtg
gtagaattaagctcccatcgccagatggtgaaagatacggataagggtgcggatcttcaa
agccagatcaaggacttggagaaacttctttacgcctatcggaatgggttgataaaggag
aaggagaggatggagagatag

DBGET integrated database retrieval system