KEGG   Parabacteroides distasonis: BDI_3671Help
Entry
BDI_3671          CDS       T00549                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_3671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_3671
   00030 Pentose phosphate pathway
    BDI_3671
   00051 Fructose and mannose metabolism
    BDI_3671
  Energy metabolism
   00680 Methane metabolism
    BDI_3671
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BDI_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4486342..4488342
Genome map
AA seq 666 aa AA seqDB search
MTKDIIAESVQNDLRYLQLLARSFPTIADASTEIINLEAILNLPKGTEHFLSDLHGEDQA
FSHVLRNASGAVKRKVNEIFSNTLRESEKKELCSLIYYPEDKLELIKSQEQDLEDWYQVT
LNQLVRVCRNVSSKYTRSKVRKALPKEFSYIIQELLHESSVEPNKSAYVDQIICTIISTG
RADDFIIAMCNLIQRLTIDLLHIIGDIYDRGPGAHLIMDILCDYHNFDVQWGNHDILWMG
AASGNLVSIANVIRMCLRFGNMATLEDGYGINLLPLATFAMEAYGDDPCALFMPKTKFAD
NAMDEKTTRLIAQMHKAITIIQFKLEGEIIRRRPEFEMDDRMLLHHIDLKRGVVHIDGKD
YTLKDTNWPTLDPKDPYRLSIEEEDLIRKILHSFESSEKMKKHMRCFFRHGGMYQVCNSN
LLFHASIPMNPDGTFKSVRILGQDYKGRALLDRVDQLIRTAYFKTGEQEEVEYAHDYIWY
LWGGKDSPLFDKSKMATFERAFIEEAETHKEEKGAYYTLREQEEICDKILDEFGVTGMHR
HIINGHVPVRSNQGENPIKANGKMLVIDGGFSRPYHLETGIAGYTLVYHSRGFQLVQHEP
FESRAKAIEEGLDIKSTTIVVELSSHRQMVKDTDKGADLQSQIKDLEKLLYAYRNGLIKE
KERMER
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagatattatagccgaatctgtacaaaacgatttacggtatttgcaattgttg
gcacggagtttcccgacgatcgcggatgccagtacggagatcattaatctggaggcgatc
ttgaacctaccgaagggtacggagcacttcttgagtgatttgcatggcgaggatcaagcc
tttagccatgtgctgagaaacgcttccggtgccgtaaagcgcaaggtgaacgagattttc
agtaatacgctccgggaatccgagaagaaggagctttgttccttgatttattatccggag
gataagctggaactgatcaagagccaagagcaagatctggaagattggtatcaagttacc
ttgaatcaattggtacgtgtttgccggaacgtgtcctccaaatacacccgttcgaaagta
cgtaaggctttacccaaggagttctcctatattattcaggagttattgcacgagtcttcc
gtagagccgaataaatccgcttatgtggatcagattatttgtacgatcatctccacggga
cgtgcggacgatttcattatcgctatgtgtaacttgatccaacggttgacaatcgacctg
ttacatatcatcggcgatatttacgatcggggtccgggcgctcatctgatcatggatatc
ctttgcgattaccataatttcgatgttcaatggggtaatcatgatatcttgtggatggga
gccgcttccggtaatttggtaagtatcgccaacgtgattcgtatgtgtttacgctttggt
aatatggctaccttagaagatggatatggtatcaatcttttgccgttggccactttcgcg
atggaggcgtatggggatgatccttgcgcgttattcatgccgaaaacaaagttcgccgat
aatgcaatggatgagaagaccacccgtttgatcgcccagatgcacaaggcgatcaccatc
atccagttcaagctggagggtgagatcatccgccgtcgtccggagtttgagatggatgac
cggatgttgttgcaccatatcgatctgaagcggggagtggttcatatcgatggaaaggat
tatacgcttaaagatactaactggcctactttagacccgaaagatccgtatcgtctttct
attgaggaagaggatttgatccgaaagatattgcattcttttgagagcagcgagaagatg
aaaaagcatatgcgttgtttcttccggcatgggggaatgtatcaggtttgtaattccaat
ttactgtttcatgcctctatcccgatgaatccggatggtacatttaagtcagtacgtatc
ttggggcaggattataagggccgtgctttgttggaccgtgtagaccaactgatccgtacg
gcttatttcaagaccggggaacaggaagaagtggaatatgcgcatgattatatctggtat
ctttggggcggcaaggactccccgttattcgataaaagcaagatggctactttcgagcgt
gcctttatcgaagaggccgagactcataaggaggaaaaaggcgcttattatacgttacga
gagcaagaggaaatttgtgataagatattggatgagtttggggtgaccggtatgcatcgg
catatcatcaacggacatgtccctgtccgttccaatcaaggtgagaatcccattaaggcg
aatggcaagatgttggtaatcgatggcggtttctcccgtccgtatcatttggaaaccggt
atcgcgggctatacattagtatatcactcccgtggtttccagcttgtgcaacacgaaccc
ttcgaatcccgggcgaaagcgatcgaggaaggcttggatatcaaatccaccacgatcgtg
gtagaattaagctcccatcgccagatggtgaaagatacggataagggtgcggatcttcaa
agccagatcaaggacttggagaaacttctttacgcctatcggaatgggttgataaaggag
aaggagaggatggagagatag

DBGET integrated database retrieval system