KEGG   Parabacteroides distasonis: BDI_3741Help
Entry
BDI_3741          CDS       T00549                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_3741
   01230 Biosynthesis of amino acids
    BDI_3741
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_3741
   00030 Pentose phosphate pathway
    BDI_3741
   00051 Fructose and mannose metabolism
    BDI_3741
   00052 Galactose metabolism
    BDI_3741
  Energy metabolism
   00680 Methane metabolism
    BDI_3741
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BDI_3741
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BDI_3741
Protein phosphatases and associated proteins [BR:pdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BDI_3741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4556684..4557664
Genome map
AA seq 326 aa AA seqDB search
MSTVKCVGILTSGGDAPGMNAAIRAVTRSAIYNGMRVKGIYRGYKGLILDEIEEFKTQNV
SNIIQRGGTILKTARCVEFKTPEGRKQAYDKLQEHGIDALIAIGGDGTLTGARIFAQEFN
FPIVGLPGTIDNDLYGTDTTIGYDTALNTIMECVDKIRDTATSHDRLFFVEVMGRDAGFL
ALNGAIASGAEAAIIPEISLEKDQLAEMIENGFRKSKNSSIVLVAESEVTGGAMGVAERV
KKEYPQFDVRVSILGHLQRGGSPTAQDRILATRMGVAAIDALLDDQRNVMMGIQNDQIVY
VPFSKAIKNDKPINRDLLNTLRVSSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagtaaagtgtgttggtattttaacgtccggaggtgatgccccgggaatgaat
gccgctattcgtgcggtaacacgttccgctatttataacggaatgagagtgaaaggtatt
taccgtggttacaaagggttgatcctagatgagattgaagagtttaagacacaaaatgtc
agtaatataattcagcgcggcggaacaatccttaagaccgcccgttgcgtggagttcaag
actcccgagggacgaaaacaggcctatgataagttgcaagagcatgggatcgatgccttg
atcgctatcggtggtgacggaacgttgacgggagcgcgtattttcgctcaggagtttaat
ttcccgatcgtaggattgccgggtacgattgataatgacttgtatggcacggatacgacg
atcggttatgatacggccttgaacacgatcatggaatgcgtggataagatccgtgatacg
gctacctcgcatgatcgtctattttttgtggaggtcatggggcgcgacgccggtttcttg
gcgttgaacggagcgatcgcttctggtgccgaagccgctattatcccggaaatctccttg
gagaaagatcaattggccgagatgatcgagaatggattccgtaagtccaagaacagtagt
atcgtattggttgccgaaagtgaggtaaccggtggcgctatgggtgtcgctgagcgtgtg
aagaaggaatatccgcagttcgatgtgcgtgtctctattttaggtcacttgcagcgtggt
ggttctcctacggcacaagaccggatcttggcgactcgtatgggtgtggccgcgatcgat
gccttgttggatgaccagcgtaacgtgatgatgggtatccagaacgaccagatcgtctat
gtaccgttctctaaagcgatcaagaatgataagcctattaaccgggatttgttgaacacg
ctccgtgtttcttcaatctaa

DBGET integrated database retrieval system