KEGG   Parabacteroides distasonis: BDI_3750Help
Entry
BDI_3750          CDS       T00549                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_3750
   00052 Galactose metabolism
    BDI_3750
Enzymes [BR:pdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BDI_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4571361..4572509
Genome map
AA seq 382 aa AA seqDB search
MKKLCFAVMAMCMLLSCGGKNEKEAATEEATLSGLMKSDFVSEVDGKPTALYVLKNKKGA
EACVTNWGGRLVSVMVPDKNGKMTDVVLGYDNIAQYVANPDMNYGALIGRYGNRIANSKF
TLDGTEYQLPQNNNGHCLHGGPKGYHAVVWDAKQVDDQTLELTYLSKDGEAGFPGNLDIK
VIYKLTDDNAVDIKYEATTDKLTVVNLTNHSYFNLSGVPGSQIMDHTIMIDADTYNPVDE
TLIPTGIEPVEGTPMDLRKPVVVGADIDNPFTQLVYGGGYDHNWILNAAGDINKVAAKVV
SPTSGIVMEVYTNEPGLQFYAGNSMTKAGDKGKLGVVYPHRGALCLETQHYPDSPNQPAF
PSVVLRPGEKYTSECIYKFSVE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgttttgcggtcatggcaatgtgtatgttattgtcatgcggaggtaag
aatgagaaggaggcggctacggaagaggccactctttctggtttgatgaagtcggatttt
gtatctgaggtagatggtaagccgactgctttgtatgtgttgaagaataagaaaggggct
gaggcttgcgtaacgaattggggcggacgcttggtttccgtgatggtgcctgataagaac
ggtaagatgacggacgtggtgctgggttacgataatatcgcgcaatacgtggcgaaccca
gacatgaattatggtgccttgatcggacgctatggcaaccgcatcgcgaatagtaagttt
acgttggacggaacggagtatcaacttccgcagaataataacggccattgcttgcatgga
ggtccgaagggatatcatgcggtagtttgggacgcgaaacaggtcgatgaccaaaccttg
gagttgacttatctatcgaaagacggtgaggcaggtttccccggtaatctggatatcaag
gtgatctataagttgacggatgataacgccgttgatattaagtacgaggctacgacggat
aaacttactgtcgtgaatttgacaaaccatagttatttcaatctttccggtgtccccggc
tcgcaaatcatggatcatacgatcatgatcgatgcggatacatataacccggtggacgag
actttgatcccgaccggtatcgaacccgtggaaggcacaccgatggatcttcgcaaaccg
gtagtggtaggcgctgatatcgacaatccgtttacgcaattggtttatggtggtggttac
gatcataactggattttgaacgccgccggcgatatcaataaggtagccgctaaagttgta
tctccgacaagcggtatcgttatggaagtttacaccaatgagccgggtcttcaattctat
gccggcaactcaatgacgaaagcgggtgataaaggcaagttaggtgtggtttacccgcat
cgtggcgctctatgtctggagactcaacattacccggatagcccgaaccagccggcattc
ccgagcgtagtgcttcgtccgggcgagaaatatacgagtgagtgtatttataagttctcg
gtagagtaa

DBGET integrated database retrieval system