KEGG   Parabacteroides distasonis: BDI_3785Help
Entry
BDI_3785          CDS       T00549                                 

Definition
(GenBank) glycoside hydrolase family 30, candidate beta-glycosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00511  Other glycan degradation
pdi00600  Sphingolipid metabolism
pdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BDI_3785
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDI_3785
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BDI_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: ABR45472
UniProt: A6LIF8
Position
4614631..4616061
Genome map
AA seq 476 aa AA seqDB search
MKIPVFILSISLYLSSCSFTPRAEWVTTTENTPWAEQPDLISALADTIPNIDITILTEKH
QQQIDGFGACFNELGWLSLSKLEPSVREEIMEELFFPGVGANFTICRMPVGANDFSRDWY
SYDEVDGDFTMEHFTIANDQQTLIPFIKNARKYQPDLRLWASPWCPPAWMKYNKHYASAY
TGENYDEKYRNGLSADKVGHEGTDMFIQDSLYLKAYALYFSKFIEAYKKHGIPIFAIMPQ
NEFNSAQIFPSCCWTSASLANFIGNYLGPAMQVQGVDIMFGTMERANESLVDTVLTDPAS
GKYVKGVGFQWAGKGAIAGIHKRYPGLKLYQTEQECGDGKNDWKGAMYSWGLMRHFLDNG
VSAYMYWNISLENGGISRWGWAQNSLVVVDPQTKSYRYTPEYYVMKHVSHYVQPGAYKLE
TEGAYTNLLAFRNPDNSIALIIANETSDDRSLSIRIGDRVYTPIVKAYSMNTLLVD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacctgtttttatactctcaatatctttatacctttcttcctgctctttcacc
ccccgtgccgagtgggtaacgacaaccgagaataccccttgggctgagcaacccgatctg
atctccgcccttgcggatacgatacctaatattgatataacaattctaacagaaaagcat
caacaacaaattgatggtttcggagcctgttttaatgaattaggttggctttccttgagt
aagctggagccaagtgtacgtgaggaaatcatggaagagctttttttccccggagtcgga
gccaacttcacgatttgccggatgcctgtaggagcaaatgatttctcccgtgattggtat
tcgtatgacgaggtagacggtgatttcacaatggaacattttaccatcgccaatgaccaa
caaacgttgattccttttatcaagaacgctcggaagtatcagccagacttacgcttgtgg
gcttccccgtggtgccctcccgcttggatgaaatataacaaacactatgcctctgcctat
acgggtgagaattatgacgagaagtatcgaaatggtttgtcggccgataaggtcggccat
gaaggtacggatatgtttatccaagactctctttacctgaaagcctatgccctctatttc
tctaaatttatcgaggcctataagaaacacggaattccaatctttgccataatgccccag
aacgagttcaactctgcgcaaatattcccgagttgttgttggacatcggcttctttggct
aattttatcggtaattatctcgggccggccatgcaggttcaaggagtggatattatgttc
ggcacgatggaacgtgcgaatgagtcgcttgttgatacggtattgacagatcccgctagt
ggtaaatatgtaaaaggtgtcggtttccaatgggcgggtaagggagctatcgccggaatc
cacaaacgttatcccgggttgaagctttaccaaaccgagcaagaatgtggagatggcaag
aacgattggaagggtgccatgtattcttgggggttgatgcgacattttctggataatggc
gtttctgcctatatgtattggaatatatctttggaaaatggagggatcagtcgttgggga
tgggcgcaaaactcattggttgtcgtagatccgcaaaccaagagctatcgatatactccg
gaatactacgtgatgaaacatgtcagccattatgtccagcccggtgcatataaattagaa
acggaaggagcctatacgaatctgctggcattccgtaacccggataacagtatcgccttg
attatcgccaatgagaccagtgatgatcgttccctttccatccgcataggcgatcgagtc
tatactccgatcgtaaaagcatattccatgaatacgctgctggtcgattga

DBGET integrated database retrieval system