KEGG   Pseudomonas aeruginosa DK2: PADK2_00180Help
Entry
PADK2_00180       CDS       T02161                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PADK2_00180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PADK2_00180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PADK2_00180 (trpA)
Enzymes [BR:pdk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PADK2_00180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(37070..37876)
Genome map
AA seq 268 aa AA seqDB search
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKE
VGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVA
GVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRI
AKARDNAQAVKDVLALCGELAEGVRNAR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgcccagctcaagcaggaaaaccgcgccgccctggtg
accttcgtcaccgccggcgacccggactacgcgtcttccctggaaatcctcaaaggcctg
ccggcggccggagccgacgtgatcgaactgggcatgccgttcaccgatccgatggcggac
ggcccggccatccagttggccaacatccgcgccctcgacggcggccagaccctggccagg
acgttgcagatggtccgcgaattccgcagcggcgacagcgagacgcccctggtgctgatg
ggctacttcaacccgatccaccactacggcgtcgaacgcttcatcgccgaggcgaaggag
gtgggggtggacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
cacccggcccaggccgccggcatcgacttcatccgcctgaccaccccgaccaccggcgac
cagcgcctgccgacggtgctagaaggcagttccgggttcgtctactacgtgtcggtggcc
ggcgtcaccggcgccaacgcggcgaccctggaacacgtcgaggaagcggtggcgcgcctg
cgccggcataccgacctgccgatcggtatcggcttcggcatccgcagcgccgaacacgcc
gccgcggtcgcgcggttggccgacggcgtggtggtcggctcggcgctgatcgaccggatc
gccaaggcccgcgacaatgcccaggcggtcaaggatgtcctcgccctgtgcggcgagctg
gccgaaggcgtgcgcaacgcacgctga

DBGET integrated database retrieval system