KEGG   Pseudomonas aeruginosa DK2: PADK2_00185Help
Entry
PADK2_00185       CDS       T02161                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PADK2_00185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PADK2_00185
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PADK2_00185
Enzymes [BR:pdk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PADK2_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(37873..39081)
Genome map
AA seq 402 aa AA seqDB search
MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALEAFHTCCRLEGIIPALESSHA
LAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQESKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgcaacggccccgacgcaaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctcgcccgcgagtacgagaaggcc
aaggacgacccggcgttccaggaggaactggcctacttccagcgcgactacgtcggtcgg
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccataccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaaacgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgccaccgtcgccgcgcgcttcggcctgcagtgcgtgatctacatg
ggcaccaccgacatcgaccggcagcaggccaacgtcttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggtaccggtaccctgaaggacgccatgaacgaggcgctg
cgcgattgggtgaccaacgtcgatagcaccttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgcgacttccaggcggtgatcggcaaggaaacccgcgag
caactggccgagaaggaagggcgcctgcccgattcgctggtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccacccgttcctcgacgacgccggggtgcagatcgtcggc
gtggaagccgccggccacggcatcgacaccggcaagcacgcggccagcctgaacggcggg
gttcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgcggatggccagatc
atcgacgcacactccatctccgccggcctcgactatcccggcatcggcccggaacacgcc
tggctgcacgacaccggccgcgtcgagtacacctcgatcaccgacgacgaagccctggag
gccttccacacctgctgccgcctcgaaggcatcatcccggcactggaaagctcccatgcc
ctggccgaggtcttcaagcgtgcgcccagcctgcccaaggagcacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagtcg
aaagcatga

DBGET integrated database retrieval system