KEGG   Pseudomonas aeruginosa DK2: PADK2_01105Help
Entry
PADK2_01105       CDS       T02161                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pdk00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(246852..247634)
Genome map
AA seq 260 aa AA seqDB search
MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEAGHDSGLAGQITSRGP
EAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRFHSWVYRARPDVNCIIH
THPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGNEEGEIISAALGDKRAIL
LSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPIPPALAREAHDWISTPKRH
GAAFNYYARRCLPRNSDCLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctacgacactggaattacccaaggatcaactgatccagcacgcgctgaagcagatg
aaaagcagcctcggcgataatacgtggactgaccggcaaaagctggccctgacctgccgg
attctcttcgaggccggccacgactccgggctcgccgggcagatcacctcgcgcggcccg
gaggcggggacctactacacccagcaactgggcctgggcttcgacgagatcagcgccggc
aacctgctgctggtcgacgaagacctcaacgtcctccacgggcacggcatggcgaatccg
gccaatcgcttccacagctgggtctatcgcgcccgcccggacgtcaactgcatcatccac
acccacccgctgcacatcgccgcgctgtcgaccctggaagtaccgctgcaggtctcgcac
atggacctttgcccgctatacgacgactgcgccttcctcaaggactggccgggcgtgccg
gtaggcaacgaggaaggcgagatcatctccgccgccctcggcgacaagcgcgccatcctg
ctctcccaccacggcctgctggccaccggtgcgagcatcgaggaggcctgcgtgatcgcg
gtgctgctcgagcgcgcggcgaagatgcagttgctggcgatggccgccggagagatcaag
ccgatcccgccggccctggcgcgcgaggcccacgactggatctccaccccgaagcgccac
ggcgccgcattcaactactacgcccggcgctgcctgccgcgcaacagcgactgcctgagc
tga

DBGET integrated database retrieval system