KEGG   Pseudomonas aeruginosa DK2: PADK2_01430Help
Entry
PADK2_01430       CDS       T02161                                 

Definition
3-guanidinopropionase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pdk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316832..317788
Genome map
AA seq 318 aa AA seqDB search
MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
LRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGDGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TMMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaccatccgcagcccctcgacgccgccgagattccacgcttcgccggcatc
ccgaccttcatgcgcctgccggcgttcaccgacccggcggcgctgcaggtcggcctgatc
ggcgtgccctgggatggcggcaccaccaaccgcgccggtgcccgccatggcccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcatcgcgccctac
gacctggtgcgggtcggtgacctcggtgatgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgcatcgaaggcttctatcgccaggtccatgccgccggtaccctgccgctg
tcggtcggtggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccattccgcagggccatcgaggaaggtctgctcgacccg
ctgcgcacggtgcagatcggcattcgcggctcggtgtattcgccggacgacgacgctttc
gcccgcgagtgcggcatccgcgtgatccacatggaagagttcgtcgaactgggcgtcgag
gcgaccctggccgaagcccggcgggtggtgggcgacgggccgacctatgtgagtttcgac
gtcgacgtgctcgacccggccttcgcgcctggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcaactggtccgcggcctgcgcgggctggacctggtcggcgcc
gacgtggtggaagtctcgccgccgttcgatgtcggcggcgccacggcgctggtgggggcg
accatgatgttcgaactgctctgcctgcttgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system