KEGG   Pseudomonas aeruginosa DK2: PADK2_03180Help
Entry
PADK2_03180       CDS       T02161                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01130  Biosynthesis of antibiotics
pdk01230  Biosynthesis of amino acids
Module
pdk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PADK2_03180 (trpC)
Enzymes [BR:pdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PADK2_03180 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFM62929
Position
682215..683051
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIA
EIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPV
IRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELE
RALKTLDTPLMGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSE
VYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGADPD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgccgacggttctgcagaagatcctcgcccgcaaggccgaggaggtcgccgag
cgccgtgcgcgcgtcaacctggccgaggtcgagcggctggcgcgtagcgccgatgcgccg
cgcggcttcgccaatgccctgctggagcgggccaagcgcaaggagccggcagtgatcgcc
gagatcaagaaggcatcgccgagcaagggcgtgctgcgcgaacacttcgtcccggcggag
atagcccgcagctacgaggcgggtggcgcggcgtgcctgtcggtgctcaccgacgtggac
ttcttccagggcgccgatgcctatctgaaggaagcgcgggccgcctgtgcgctgccggtg
atccgcaaggacttcatgatcgatccgtaccagatcgtcgaggcgcgggcgatcggtgcc
gactgcatcctgctgatcgtctcggcgctggacgacgtgctgatggccgaactggcggcg
actgccaagtcggtcggtctcgacgtactggtcgaagtgcatgacggcaccgagctggaa
cgtgcgctgaagaccctggacacgccgttgatgggcatcaacaaccgcaacctgcacacc
ttcgaggtgagcctggaaaccaccctcgacctgttgccggaaattccccgcgaccgcctg
gtggtcaccgagagcggtattctcaaccgggccgacgtggagctgatggaagtcagcgag
gtctacgccttcctggttggcgaggcgttcatgcgggccgacgatcctggcctggagttg
aagcgcctgttcttccaggagcgtggcggcgtggtgctgggcgccgatcctgactga

DBGET integrated database retrieval system