KEGG   Pseudomonas aeruginosa DK2: PADK2_05660Help
Entry
PADK2_05660       CDS       T02161                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PADK2_05660
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PADK2_05660
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PADK2_05660
Enzymes [BR:pdk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PADK2_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1219151..1220560
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWVGLPYHELAFRVMR
PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPHNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGKLSVEDQRWTEARKLFDS
LAVSDEQTCETIAEVYRSCGELLDPHTAIGVRAARECRRSLSVPMVTLGTAHPVKFPEAV
EKAGIGQAPALPAHLADLFEREERCTVLPNELAKVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagcacccgcggccaagcgcccgccctgaacttcgaagatgtcctcctc
gccggcctggccagcgacggcggcctctacgtcccggaaaacctgccacgcttcaccctc
gaggagatcgcctcctgggtcggcctgccctaccacgagctggccttccgggtgatgcgc
ccgttcgtcgccggcagcatcgccgatgccgacttcaagaagatcctcgaggaaacctat
ggcgtcttcgcccatgacgcagtggcgccgctgcgccagttgaacggcaacgaatgggtg
ctggagctgttccacggcccgaccctggccttcaaggacttcgccctgcaactgctcggc
cgcctgctcgaccatgtgctggccaagcgcggcgagcgcgtggtgatcatgggggccacc
tccggcgataccggctccgcggccatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcatgcacccgcacaaccgcgtgtccgaggtgcagcgccggcagatgaccaccatc
ctcggcgacaacatccacaacatcgccatcgaaggcaacttcgatgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaagggtacccgcctggtagcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcgctgcag
ctcggcgcgccgcatcgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccagctgatcgtcgcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggtaatcgctacgacaaggacaccctg
catccctcgctgtcgccgtcgatggatatcatggtctcgtccaacttcgaacgcctgttg
ttcgacctgcacggccgcaacggcaaggccgtcgccgaactgctggatgccttcaaggcc
agcggcaagctgtcggtggaagaccagcgctggaccgaggcgcgcaagctgttcgactcc
ctggcggtcagcgacgagcagacctgcgagaccatcgccgaggtataccgctcctgtggc
gagttgctcgacccgcacaccgccattggcgtgcgtgccgcccgcgaatgccggcgcagc
ctgagcgtgccgatggtgaccctgggcactgcgcatccggtcaagttccccgaagcggtg
gagaaggccggcatcggccaggcgccggcgctgcctgcgcacctcgccgacctgttcgag
cgcgaggagcgctgcaccgtattgccgaacgagctggccaaggtacaggccttcgtcagc
cagcacggcaatcgcggcaagccgctctga

DBGET integrated database retrieval system