KEGG   Pseudomonas aeruginosa DK2: PADK2_06430Help
Entry
PADK2_06430       CDS       T02161                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PADK2_06430 (glpK)
Enzymes [BR:pdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PADK2_06430 (glpK)
Exosome [BR:pdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADK2_06430 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1392138..1393655)
Genome map
AA seq 505 aa AA seqDB search
MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDPMEIWATQ
SSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSAAICAQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGARERARNGDLLFGTIDTWLIWKLTEG
KVHVTDYTNASRTMLFNIHSLDWDARMLEVLDIPRSMLPEVRNSSEVYGNARIGGVGGGE
LPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRG
EVGYALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYW
DPYARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLRALRVDGGAVANN
FLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKSKAVIERVFEPECDE
PRREKLYAGWKKAVERTRGWDDGEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcacaacaagaaatacgtcgtcgccctggaccagggcaccaccagctcc
cgcgccatcgtcttcgaccgcgatgccaacgtggtcagccaggcccagcgcgagttcgcc
cagttctatccgcaggccggctgggtcgagcacgacccgatggaaatctgggccacgcag
agttcgaccctggtcgaggccctcgcccaggccagcatcgagcacgaccaggtggccgcc
atcggtatcaccaaccagcgcgagaccacggtggtctgggaccgtcacagcggtcggccg
atccacaacgccatcgtctggcagtgccggcgcagcgcggcgatctgcgcgcagctcaag
cgcgacgggctggaagactacatccgcgaaaccaccgggctggtcaccgatccgtacttc
tccgggaccaagctgaagtggatcctcgacaacgtcgaaggcgcccgcgaacgcgcgcgc
aacggcgacctgttgttcggcaccatcgacacctggctgatctggaagctcaccgaaggc
aaggtccacgtcaccgactacaccaatgcctcgcggaccatgctgttcaacatccacagc
ctcgactgggacgcacggatgctcgaggtgctcgacattccccgctcgatgctgcccgag
gtgcgcaactcttcggaggtctacggcaacgcccggatcggcggggtcggcggcggcgag
ctgccgatcgccgggatcgccggcgaccagcaggccgccctgttcggccagatgtgcgtg
gaaccgggccaggcgaagaacacctacggcaccggctgcttcctgctgatgcacaccggc
gacaaggcggtgaagtccacccatggcctgctcaccaccatcgcctgcggcccgcgcggc
gaggtcggctacgccctggagggcgcggtgttcaacggcggctccacggtgcagtggttg
cgcgacgaactgaaggtgatcaacgactccttcgattccgaatacttcgccaccaaggtc
aaggacagcaacggcgtctacctggtaccggccttcaccggactcggcgcgccctattgg
gacccctatgcgcgcggcgcagtgttcggcctgacccgtggagtcaaggccgaccacctg
atccgcgctaccctggaatccatcgcctaccagacccgcgacgtgctcgacgccatgcag
cgcgatgccggcgaacgcctgcgcgccctgcgcgtcgacggcggggcggtggccaacaac
ttcctcatgcagttccaggccgacatcctcggcacccgcgtggaacgtccggtgatgcgc
gagaccaccgccctcggcgccgcctacctggccggcctggcctgcggcttctggagcagc
ctcgacgagctgaagagcaaggcggtgatcgagcgggtgttcgagccggagtgcgacgag
ccccggcgcgaaaagctctatgccggctggaagaaagcggtggagcgcactcgcggctgg
gacgacggcgaactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system