KEGG   Pseudomonas aeruginosa DK2: PADK2_06430Help
Entry
PADK2_06430       CDS       T02161                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pdk00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1392138..1393655)
Genome map
AA seq 505 aa AA seqDB search
MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDPMEIWATQ
SSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSAAICAQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGARERARNGDLLFGTIDTWLIWKLTEG
KVHVTDYTNASRTMLFNIHSLDWDARMLEVLDIPRSMLPEVRNSSEVYGNARIGGVGGGE
LPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRG
EVGYALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYW
DPYARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLRALRVDGGAVANN
FLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKSKAVIERVFEPECDE
PRREKLYAGWKKAVERTRGWDDGEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcacaacaagaaatacgtcgtcgccctggaccagggcaccaccagctcc
cgcgccatcgtcttcgaccgcgatgccaacgtggtcagccaggcccagcgcgagttcgcc
cagttctatccgcaggccggctgggtcgagcacgacccgatggaaatctgggccacgcag
agttcgaccctggtcgaggccctcgcccaggccagcatcgagcacgaccaggtggccgcc
atcggtatcaccaaccagcgcgagaccacggtggtctgggaccgtcacagcggtcggccg
atccacaacgccatcgtctggcagtgccggcgcagcgcggcgatctgcgcgcagctcaag
cgcgacgggctggaagactacatccgcgaaaccaccgggctggtcaccgatccgtacttc
tccgggaccaagctgaagtggatcctcgacaacgtcgaaggcgcccgcgaacgcgcgcgc
aacggcgacctgttgttcggcaccatcgacacctggctgatctggaagctcaccgaaggc
aaggtccacgtcaccgactacaccaatgcctcgcggaccatgctgttcaacatccacagc
ctcgactgggacgcacggatgctcgaggtgctcgacattccccgctcgatgctgcccgag
gtgcgcaactcttcggaggtctacggcaacgcccggatcggcggggtcggcggcggcgag
ctgccgatcgccgggatcgccggcgaccagcaggccgccctgttcggccagatgtgcgtg
gaaccgggccaggcgaagaacacctacggcaccggctgcttcctgctgatgcacaccggc
gacaaggcggtgaagtccacccatggcctgctcaccaccatcgcctgcggcccgcgcggc
gaggtcggctacgccctggagggcgcggtgttcaacggcggctccacggtgcagtggttg
cgcgacgaactgaaggtgatcaacgactccttcgattccgaatacttcgccaccaaggtc
aaggacagcaacggcgtctacctggtaccggccttcaccggactcggcgcgccctattgg
gacccctatgcgcgcggcgcagtgttcggcctgacccgtggagtcaaggccgaccacctg
atccgcgctaccctggaatccatcgcctaccagacccgcgacgtgctcgacgccatgcag
cgcgatgccggcgaacgcctgcgcgccctgcgcgtcgacggcggggcggtggccaacaac
ttcctcatgcagttccaggccgacatcctcggcacccgcgtggaacgtccggtgatgcgc
gagaccaccgccctcggcgccgcctacctggccggcctggcctgcggcttctggagcagc
ctcgacgagctgaagagcaaggcggtgatcgagcgggtgttcgagccggagtgcgacgag
ccccggcgcgaaaagctctatgccggctggaagaaagcggtggagcgcactcgcggctgg
gacgacggcgaactgtga

DBGET integrated database retrieval system