KEGG   Pseudomonas aeruginosa DK2: PADK2_06445Help
Entry
PADK2_06445       CDS       T02161                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pdk00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395333..1396817
Genome map
AA seq 494 aa AA seqDB search
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCR
DALARKGLRAADIAAIGITNQRETTLVWDAASGDLIHPAIVWQDRRTADYCAELKAAGHE
ANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRT
DATNASRTLLFNIHSQDWDEELLALFEIPRSLLPEVLDCAAEFGVSEPSLLGAAIPVLGM
AGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAV
EGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWVMQFLT
DILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFAAHMAEERRGELY
AGWQNAVRRVRSEA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactatctcctcgccatcgaccagggcaccaccagctcccgcgccatcgtgttc
agtgcccagggcttgccggtggcgagctgccagcaggaattcaagcagtacttcccgaag
gacggctgggtggagcacgacggcgaggaaatctggctgaccaccctccaggtctgtcgc
gacgcgctcgcccgcaagggcttgcgcgcggccgacatcgccgccatcggcatcaccaac
cagcgcgagaccacgctggtctgggacgccgccagcggcgacctgatccacccggccatc
gtctggcaggatcgtcgtaccgccgactactgtgccgaactcaaggccgccggccacgag
gccaatgtcagcgcgcgcaccgggctgctgatcgatccgtatttctccgccaccaagctg
cgctggatcctcgacaacgtgcccggcgcccgccagcgcgccgaacgcggcgagctgcgc
ttcggcaccgtcgactgcttcctgctctggcgcctgaccggcggccgctcccatcgcacc
gacgcgaccaacgcttcgcgcaccctgctgttcaacatccacagccaggactgggacgag
gaattgctggcgctgttcgagatcccgcgcagcctgctgccggaggtactcgactgcgcg
gcggagttcggcgtcagcgagccgtcgctgcttggcgcggcgatcccggtgctgggcatg
gccggcgaccagcaggccgcgctgatcggccaggcctgcttccagccgggcatggtgaag
agcacctacggcaccggctgcttcatgatccagaacaccggcgagcagccggtgacctcg
aagaaccgcctgctcaccacggtcggctaccgtctggacggcaaggtcagctacgcggtg
gagggcagcatcttcgtcgccggcgccgcggtgcaatggctgcgcgacggcatcaagctg
atcgaccacgcccacgagagcgaagccctggcgatccaggccggcgactccaacggcgtc
tacctggtgccggccttcaccggcctcggcgcgccctactgggacccgaaggcgcgcggc
gcgatcttcggcctgacccgtgacaccggaatcaaggagatcgtcaccgccggtctgcaa
tcggtctgctaccagacccgcgacctgctcgaagcgatgcgccaggacggcacgccgccc
agcgcgctgcgggtggacggcgggatggtggtgaacaactgggtgatgcaattcctcacc
gacatccttggtgtcaccgtggagcgcccggaagtcaccgagaccaccgccctcggcgtg
gcctacatggccgggctgaaggccggcttctatcgcgacctggacgacatcgccagccac
tggcacctgcagcgccgcttcgccgcgcacatggccgaggagcgccgcggcgaactctac
gccggctggcagaacgcggtgcgacgggtgcgcagcgaggcctga

DBGET integrated database retrieval system