KEGG   Pseudomonas aeruginosa DK2: PADK2_08365Help
Entry
PADK2_08365       CDS       T02161                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PADK2_08365 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_08365 (glk)
   00052 Galactose metabolism
    PADK2_08365 (glk)
   00500 Starch and sucrose metabolism
    PADK2_08365 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PADK2_08365 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PADK2_08365 (glk)
   00524 Butirosin and neomycin biosynthesis
    PADK2_08365 (glk)
Enzymes [BR:pdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PADK2_08365 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805725..1806720
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFASRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggcggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccgcggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggtcggggcggcggat
ttccgtttcaccaacaaccactgggtgatcaatcgtgccgcgttccgcgaggaactgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggctg
ggcgcggacgagctggtgcaggtccgcgccggcagcgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggcgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcatgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacacgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgtgccctggacggggtcgccgtc
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgc
ttcatcgccagcggtttcgccgaggccttcgccagccgtggcaagaccagtggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgcttggcgccggc
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system