KEGG   Pseudomonas aeruginosa DK2: PADK2_09320Help
Entry
PADK2_09320       CDS       T02161                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PADK2_09320
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PADK2_09320
Enzymes [BR:pdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PADK2_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2022488..2023471
Genome map
AA seq 327 aa AA seqDB search
MLDIGGTWLTAEDRQILRHPEVGGLIIFARNIEHPAQVRELCAAIRAIRPDLLLAVDQEG
GRVQRLRQGFVRLPAMRAIADNPNAEELAEHCGWLMATEVQAVGLDLSFAPVLDLDHQRS
AVVGSRAFEGDPERAALLAGAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPEDARSLE
EIRRSDLVPFARLAGQLDALMPAHVIYPQVDPQPAGFSRRWLQEILRGELKFDGVIFSDD
LSMAGAHVVGDAASRIEAALAAGCDMGLVCNDRASAELALAALQRLKVTPPSRLQRMRGK
GYANTDYRQQPRWLEALSALRAAQLID
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcggcggcacctggctgaccgccgaggaccgccaaatcctgcgccacccc
gaggtgggcgggctgatcatcttcgctcgcaacatcgagcatcctgcccaggttcgcgaa
ctgtgtgcggccattcgcgccatccgtcccgacctgttgctggccgtcgaccaggaagga
gggcgcgtgcagcgcctgcgccagggcttcgtgcgcctgccggcgatgcgcgcgatcgcc
gacaaccccaatgccgaagagctggccgagcactgtggctggttgatggcgaccgaggtg
caggcggtaggcctcgacctgagtttcgcgccggtgctggatctcgatcaccagcgtagc
gccgtggtcggtagccgcgccttcgagggcgacccggagcgtgccgcgctgcttgccggt
gctttcattcgcggcatgcatgccgccgggatggccgccaccggcaagcattttcccggt
cacggctgggccgaggccgactcccatgtggcgattcccgaagacgcgcgcagcctcgag
gaaatccggcgcagcgacctggttccgttcgcccgcctggccggacagctcgacgcgctg
atgccggcccatgtcatctatccgcaggtcgacccgcagcccgccggcttttcccggcgc
tggttgcaggagatcctgcgcggcgagctgaagttcgacggggtgatcttcagcgacgac
ctgtcgatggccggcgcccatgtggtcggcgacgccgccagccgcatcgaggccgccctg
gccgcgggctgcgacatgggtctggtgtgcaacgaccgggcttccgccgagctggccctg
gctgccctgcaacgcctgaaggtgaccccgccgtcgcgtctgcaacgcatgcgcggcaag
ggctacgcgaataccgactatcgccagcagccgcgctggctggaagcactgtccgcgttg
cgcgccgcgcaactgattgattga

DBGET integrated database retrieval system