KEGG   Pseudomonas aeruginosa DK2: PADK2_09650Help
Entry
PADK2_09650       CDS       T02161                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pdk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2090306..2091322
Genome map
AA seq 338 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQPPPAERAE
IIRRRLAFDADPQAFVERWEGQQDTLRRRCAEARRRLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSNPPPSAANPPPPPAAA
PVALPERTGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgaactgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccgggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaagttaacctgctgccggaccacctggtggatttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgcctcgatacccagccgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgctgggaa
ggccagcaggacaccctgcgccgccgttgcgccgaggcgcgccggcggctggcgcggatt
cccctggacgatgcggcgctggacagcatcgctcgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgaacccgccaccatcggcggccaatccaccgccaccgcccgcggcggcc
cctgtcgcgctcccggagcgcaccggcgacggcgaagggcagtggggcgaattgccggct
cggccggtggccatggggaccgcccgcgagctgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system