KEGG   Pseudomonas aeruginosa DK2: PADK2_10095Help
Entry
PADK2_10095       CDS       T02161                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PADK2_10095
Enzymes [BR:pdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PADK2_10095
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PADK2_10095
Lipid biosynthesis proteins [BR:pdk01004]
 Fatty acid synthase
  Component type
   PADK2_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2179936..2180541
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLASMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSRVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
caaggctgggtcgccctgctgcagaagcgcctcgccgacgaaggttacgactaccgggtg
gtgaacgcctcgatcagcggcgacacctccgcgggtggcctggcgcgcctgccggcgctg
cttgccgaggagaagccggcgctggtggtgatcgagctgggaggcaacgacgggctgcgc
ggaatggcaccggcgcaattgcaacagaatcttgccagcatggcgcaaaaggcccgggcg
gaaggagcgaaggtgctgctgctgggtatccagttgccaccgaactacggcccgcgctac
atcgaggccttttccagggtctacggcgcggtcgcggcgcaggaaaagaccgccctggtg
ccgtttttcctcgaaggggtcggcggggtccaggggatgatgcaggcggatggcatccat
ccggcgctcgccgcccagccgaggctcctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system