KEGG   Pseudomonas aeruginosa DK2: PADK2_10095Help
Entry
PADK2_10095       CDS       T02161                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pdk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2179936..2180541
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLASMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSRVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
caaggctgggtcgccctgctgcagaagcgcctcgccgacgaaggttacgactaccgggtg
gtgaacgcctcgatcagcggcgacacctccgcgggtggcctggcgcgcctgccggcgctg
cttgccgaggagaagccggcgctggtggtgatcgagctgggaggcaacgacgggctgcgc
ggaatggcaccggcgcaattgcaacagaatcttgccagcatggcgcaaaaggcccgggcg
gaaggagcgaaggtgctgctgctgggtatccagttgccaccgaactacggcccgcgctac
atcgaggccttttccagggtctacggcgcggtcgcggcgcaggaaaagaccgccctggtg
ccgtttttcctcgaaggggtcggcggggtccaggggatgatgcaggcggatggcatccat
ccggcgctcgccgcccagccgaggctcctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system