KEGG   Pseudomonas aeruginosa DK2: PADK2_12455Help
Entry
PADK2_12455       CDS       T02161                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PADK2_12455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADK2_12455
   00620 Pyruvate metabolism
    PADK2_12455
   00640 Propanoate metabolism
    PADK2_12455
  Energy metabolism
   00680 Methane metabolism
    PADK2_12455
Enzymes [BR:pdk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PADK2_12455
Lipid biosynthesis proteins [BR:pdk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PADK2_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2629165..2630832
Genome map
AA seq 555 aa AA seqDB search
MRDYATTAAGFDLQRTAAATLSGTLQALNACVECCDRHALPGRIALFWEGKDGSRASYTF
SELKALSGRFANFLQAQGVRPGDCVAGLLPRTPELLVTILGAWRLGAVYQPLFTAFGPKA
IEHRVATAGSKVLVTDAANRDKLDELADPPLAVTVGGPKGQGIRRGDFSFWAELERYPAE
FEPVPRSGEDPFLMMFTSGTTGLAKPVPVPLKAILAFVGYLREAVDLRPEDAFWNLADPG
WAYGLYYAVAGPLAMGHPTTFYEGPFSVESTCRIIRDYGITNLAGSPTAYRLLMAAGAAA
ETALKGRLRAVSSAGEPLTPEVIRWFADRLGTTIHDHYGQTELGMVLCNHHALAHPVRVG
AAGFACPGHRVVVLDDDLNELPPGQPGILALDRRRSPLMWFPGYQGLETAAFVGDYYLSG
DTVELNEDGSISFVGRADDVITTSGYRVGPFDVESALIEHPAVMEAAVIGKPDPERTELV
KAFVVLCAGHRPTPELADALQRYVRQRLSAHAYPREIEFLEELPKTPSGKIQRFLLRNQE
IARQREAAPRAAAAN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgccaccactgccgccgggttcgacttgcagcggaccgccgccgccacg
ctttccggtacgctccaggcgctcaacgcctgcgtcgaatgctgcgaccggcatgccctg
ccgggacggatcgcgttgttctgggagggcaaggatggcagtcgcgccagctataccttc
agcgagctgaaagcgctctccggacgtttcgccaatttcctccaggcccagggcgtacgc
ccgggcgactgcgtcgccggcctgttgccgcgcacgcccgagcttctggtcaccatcctc
ggcgcctggcgcctgggcgcggtgtaccagccgctgttcaccgccttcggcccgaaggcc
atcgaacaccgcgtggcgaccgccggcagcaaggtgctggtcaccgatgcggccaaccgc
gacaagctcgacgaactcgccgatccgcctctggccgtcaccgtcggcggaccgaagggg
cagggcatccgtcgcggcgatttcagcttctgggccgagctggagcgctatccggccgaa
ttcgaaccggttccgcgcagcggcgaggatccgttcctgatgatgttcacctccggcacc
accggcctggccaaaccggtgccggtgccgctcaaggcgatcctcgccttcgtcggctac
ctgcgcgaggcggtggacctgcgccccgaggacgccttctggaacctcgccgatccgggc
tgggcctacggcctctactacgctgtcgccggtcccctcgccatgggccatccgaccacc
ttctacgaagggccgttcagcgtggaaagcacctgccggatcatccgtgactacggcatc
accaaccttgccggatcgcccaccgcctatcgcctgctgatggccgccggcgcggccgcg
gaaactgcgctgaaggggcgcctgcgcgcggtcagcagcgccggcgagccgttgaccccg
gaggtgatccgctggttcgccgacaggctcggcaccaccatccacgatcattacgggcag
accgagctgggcatggtgctgtgcaaccaccatgccctggcgcatccggtgcgggtcggc
gccgccgggttcgcctgtcccgggcaccgggtagtagtgctggacgacgatctcaacgaa
ctgccgcccggccagccaggcatcctcgccctcgaccggcggcgttcgccgctgatgtgg
tttcccggctaccagggcctggaaaccgcagccttcgtcggcgactactacctgagcggc
gataccgtcgaactcaacgaagacggcagcatcagcttcgtcggccgcgccgacgacgtc
attaccacctctggctaccgggtcggcccgttcgatgtggagagcgcgctgatcgaacac
ccggcagtgatggaggcggcggtgatcggcaagcccgacccggagcgcaccgaactggtc
aaggccttcgtcgtgctctgcgccggccaccggccgacgccggaactggcggacgcattg
cagcgatacgtgcgccagcgcctgtcggcgcacgcctacccgcgggagatcgagttcctc
gaggaactgccgaagactcccagcggcaagatccagcgctttctcctgcgcaaccaggag
atcgcccggcaacgcgaggcggccccacgggcggccgccgcgaactga

DBGET integrated database retrieval system