KEGG   Pseudomonas aeruginosa DK2: PADK2_12465Help
Entry
PADK2_12465       CDS       T02161                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00071  Fatty acid degradation
pdk00072  Synthesis and degradation of ketone bodies
pdk00280  Valine, leucine and isoleucine degradation
pdk00310  Lysine degradation
pdk00362  Benzoate degradation
pdk00380  Tryptophan metabolism
pdk00620  Pyruvate metabolism
pdk00630  Glyoxylate and dicarboxylate metabolism
pdk00640  Propanoate metabolism
pdk00650  Butanoate metabolism
pdk00900  Terpenoid backbone biosynthesis
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
pdk01212  Fatty acid metabolism
pdk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PADK2_12465
   00630 Glyoxylate and dicarboxylate metabolism
    PADK2_12465
   00640 Propanoate metabolism
    PADK2_12465
   00650 Butanoate metabolism
    PADK2_12465
  Lipid metabolism
   00071 Fatty acid degradation
    PADK2_12465
   00072 Synthesis and degradation of ketone bodies
    PADK2_12465
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PADK2_12465
   00310 Lysine degradation
    PADK2_12465
   00380 Tryptophan metabolism
    PADK2_12465
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PADK2_12465
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PADK2_12465
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PADK2_12465
Enzymes [BR:pdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PADK2_12465
Exosome [BR:pdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADK2_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFM64776
Position
2631637..2632827
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggtgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccggactggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccatgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgtgccgaggcctacggcttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgtctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system