KEGG   Pseudomonas aeruginosa DK2: PADK2_14900Help
Entry
PADK2_14900       CDS       T02161                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PADK2_14900
Enzymes [BR:pdk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PADK2_14900
Exosome [BR:pdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADK2_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3214321..3216507)
Genome map
AA seq 728 aa AA seqDB search
MSERERWQLELDKLQRGLQGDPFAFLGPQRDPGGEGGVLRAYLPGAQRVELLDEDGATLA
ELEQSDPGSGLFQRHLERLPPRYSLRVHWPDGVQESEDPYAFGPLLGELDLYLFAEGNHR
QLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDGRRHPMRRRYPSGVWELFV
PRLGEGELYKYELQGHDGLLPLKADPLALACETPPGTASKTCAALRHEWRDQDWLARRAE
RQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHPFGGS
WGYQPLGLFAPTARYGTPEDFAAFVDACHQAGIGVILDWVPAHFPTDAHGLGRFDGTALY
EYEHPFEGFHQDWDTYIYNLGRSEVHGFMLASALHWLRTYHVDGLRVDAVASMLYRDYSR
KEGEWLPNRHGGRENLEAIDFLHHLNQVVASEIPGALVIAEESTAWPGVSRPVAEGGLGF
SHKWNMGWMHDSLAYIGEDPLHRRYHHHQLTFGLLYAFSEHFILPISHDEVVHGKHSLLD
KMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDGELDWYLLRYPEHQGV
QDLVAALNRLYRELPALHARDGEALGFEWLIGDDQANSVYAWLRHAAGEPSLLAVHNFTP
VPRQGYRIGVAQGGDWDVLLNSDAQAFAGSGAGSQGRVSSESCGAHGQAQSLVLDLPPLG
TLLLRPAG
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacgcgaacgctggcaactggagctggacaagctgcagcgtggcctgcagggc
gatccattcgccttcctcggcccgcagcgcgaccccggcggcgaaggcggcgtgctgcgc
gcctacctgcccggcgcgcagcgcgtcgagctgctcgacgaagacggcgcgacgctcgcc
gaactggagcagagcgaccccggcagcggcttgttccagcgccacctggagcgcctgcca
ccgcgctacagcctgcgcgtgcactggccggacggcgtgcaggaaagcgaagacccctat
gccttcgggccgttgctcggcgaactcgacctctacctgttcgccgaaggcaaccaccgc
caactggcctcctgcctgggcgcgcaactgacccgtcacgaaggcgtggagggcgtgcgc
ttcgcggtctgggcgccgaacgccgtgcgcgtctcggtggtcggcgatttcaacggctgg
gacgggcgccgtcacccgatgcgacgacgctatccatccggcgtctgggaactgttcgtc
ccgcgcctcggcgagggcgaactgtacaagtacgagttgcagggccacgacggcctcctg
ccgctgaaggccgaccccctggcgctggcctgcgagacgccgcccggaaccgcttcgaag
acctgcgcggcgttgcgccacgagtggcgcgaccaggactggctggcccggcgcgcggag
cgccagggctatgcggcaccgctgtcgatctacgaagtccacgccggctcctggcgccac
cgcgacggccggccgccgcactggtcggaactggcggaggagctgattccctacgtgcgc
cagctcggcttcacccatatcgagctgatgccggtgatggaacatcccttcggcggctcc
tggggctaccagccgctcgggttattcgcccccaccgcgcgctacggcacgccggaggac
ttcgccgcgttcgtcgacgcctgccaccaggccggcatcggcgtgatcctcgactgggtg
ccggcgcattttcccaccgacgcccacggcctgggccgtttcgacggcacggcgctgtac
gagtacgaacatcccttcgaaggcttccaccaggactgggatacctacatctacaacctt
ggccgcagcgaggtgcacggcttcatgctggcctcggcgctgcactggctgcgcacctac
cacgtcgacggcctgcgggtggatgcggtggcctcgatgctctaccgcgactattcgcgc
aaggaaggcgaatggctgccgaaccgccatggcggccgggagaacctggaggccatcgac
ttcctccatcacctcaaccaggtggtcgccagcgaaatccccggcgcgctggtgatcgcc
gaggaatccaccgcctggcccggcgtcagccgtccggtggcggagggcggcctgggcttc
agccataagtggaacatgggctggatgcacgacagcctggcgtacatcggcgaagacccg
ctgcaccggcgctatcaccaccaccagttgaccttcggcctgctctacgccttctccgag
catttcatcctgccgatctcccacgacgaggtggtacatggcaagcactcgctactggac
aagatgcccggcgaccgctggcagaagttcgccaacctgcgcctgtacctgagcttcatg
tggtcgcacccgggcaagaagctgctgttcatgggatgcgagttcggccagtggcgcgag
tggaaccacgacggcgaactggactggtacctgctgcgctatccggagcatcagggcgta
caggacctggtggcggccctcaaccggttgtaccgcgaactccccgcactgcatgcgcgc
gacggcgaggcgctcggcttcgaatggctgatcggcgacgaccaggcgaacagtgtctac
gcctggctgcgccacgcggccggcgagccatcgctgctggcggtacacaattttaccccg
gtgccgcgccagggctatcggatcggcgtagcgcaaggcggcgactgggacgtgctgctc
aatagcgacgcccaggcgttcgccggttccggcgcaggcagccagggccgcgtctccagc
gagtcgtgcggcgcccatggccaggcgcagtcgctggtgctcgacctgccgccgctgggc
acgctgctgctgcgtccggccggctga

DBGET integrated database retrieval system