KEGG   Pseudomonas aeruginosa DK2: PADK2_15530Help
Entry
PADK2_15530       CDS       T02161                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PADK2_15530
   00052 Galactose metabolism
    PADK2_15530
   00500 Starch and sucrose metabolism
    PADK2_15530
   00520 Amino sugar and nucleotide sugar metabolism
    PADK2_15530
Enzymes [BR:pdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PADK2_15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3363245..3364084)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggttacggcacccgtttcctccccgccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaagccggcctttccgagatcggcatcgtcaccggccgcggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctggaacaccagatccgcaacaccgac
aaggaaaagtacctggtcggcatccgtcggctgatcgacgagtgcaccttcgcctacacc
cgccaggtggagatgaagggcctcggccacgccatcctcaccggtcgtccgctgatcggc
gacgagccgttcgccgtggtcctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaagagaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gatatcttccgggtgaacaccatggtcgagaagccgaagccggaagaggcgccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggacatcttcgacctgatcgagcagact
gaaccgggcaagggcggcgagatccagatcaccgatgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system