KEGG   Pseudomonas aeruginosa DK2: PADK2_15635Help
Entry
PADK2_15635       CDS       T02161                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pdk00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pdk00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3388330..3389100
Genome map
AA seq 256 aa AA seqDB search
MTLKGKTALVTGSTSGIGLGIALSLAEAGADLLLNGFGEVDAALAQVRARGVRAEHHPAD
LSSPEQIGELMAFAERTFGGVDILVNNAGIQYVAPVQEFPTERWDAIIAINLSSVFHTTR
LALPGMLARGWGRIVNIASTHGLVASAGKSAYVAAKHGVLGLTKSVALETARTPVTCNAI
CPGWVLTPLVQKQIDARTAEGVSPEQAEHDLLAEKQPSLAFVTPEQLGGLTLFLCSEAAD
QVRGAAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaaaggcaagaccgccctggtcaccggttccaccagcggcatcggcctgggc
atcgccctgagcctggccgaggccggcgccgacctgctcctcaacggcttcggcgaggtc
gacgcggcactggcgcaggtccgcgcccgcggcgtgcgcgcagagcaccacccggccgac
ctctccagcccggagcagatcggcgaactgatggccttcgccgagcggaccttcggcggc
gtcgacatcctcgtcaacaacgccggcatccagtacgtggcgccggtgcaggaattcccc
acggaacgctgggacgcgatcatcgcgatcaacctgtcctcggtgttccataccacccgc
ctggccctgccgggcatgctcgcgcgcggctgggggcggatcgtcaacatcgcctcgacc
cacggcctggtcgcctcggccgggaagagcgcctacgtcgccgccaagcatggcgtgctc
ggcctgaccaagagtgtggcgctggaaacggcgcgcacgccggtgacctgcaacgccatc
tgccccggctgggtgctgaccccgttggtgcagaagcagatcgacgcgcgcaccgccgag
ggcgtctcgcccgaacaggcggaacatgacctgctggcggaaaagcaaccctcgctggcc
ttcgtcacccccgagcaactcggcggactgacgctgttcctttgcagcgaagccgccgac
caggtgcgcggcgcggcctggaacatggatggcggctgggtggcgcagtag

DBGET integrated database retrieval system