KEGG   Pseudomonas aeruginosa DK2: PADK2_17520Help
Entry
PADK2_17520       CDS       T02161                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pdk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pdk00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:pdk00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3785467..3786375)
Genome map
AA seq 302 aa AA seqDB search
MQQLLNEILDEVRPLIGRGKVADYIPALAGVEPNQLGIAVYSRDGELFHAGDALRPFSIQ
SISKVFSLVQAIQHSGEDIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRFAAPAQSMRDFVRRLCGNPEVVSDSVVARSEYQHRSRNAAAAYLMKSFGNFHNDVE
AVLLSYFHHCALRMSCVDLARAFCFLADKGFCKHSGEQVLNERQTKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAVVPGRFTVCVWSPELNAAGNSLAGIAALEKLSERIGWS
IF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactgttgaacgagattctcgatgaagtccgcccgctgatcgggcgcggcaag
gtcgccgactacatccccgcgctcgccggcgtcgagccgaaccagctggggatcgccgtg
tacagccgcgacggcgagctgttccatgccggcgacgccctgcggccgttttccatccag
agcatttccaaggtgttcagcctggtccaggcgatccagcattccggcgaggacatctgg
caacgccttggccacgagccctccggccagcctttcaactccctggtgcagctggagttc
gagcgcggcaagccgcgcaacccgttcatcaatgccggcgccctggtgatctgcgacatc
aaccagtcgcgtttcgccgcgccggcgcaatcgatgcgcgatttcgtccggcgcctgtgc
ggcaacccggaagtggtgtcggactcggtggtggcgcgctcggagtaccagcaccgctcg
cgcaacgcggcggcggcctacctgatgaaatcgttcggtaacttccacaacgacgtcgag
gcggtgctgctcagctatttccatcattgcgcgctgcgcatgagctgcgtcgacctggcg
cgggcgttctgcttcctcgccgacaagggcttctgcaagcacagcggcgagcaggtactc
aacgagcggcagaccaagcaggtcaacgcgatcatggccaccagcgggctatacgacgag
gccggcaactttgcctatcgggtcggcctgccaggcaagagcggtgtcggcggcggcatc
atcgcggtagtgccggggcgcttcacggtctgtgtctggtcgccggaactgaacgccgcg
ggcaattcgctggcgggtatcgccgcgctggagaaactcagcgagcggatcggctggtcg
atcttctga

DBGET integrated database retrieval system