KEGG   Pseudomonas aeruginosa DK2: PADK2_17765Help
Entry
PADK2_17765       CDS       T02161                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00020  Citrate cycle (TCA cycle)
pdk00640  Propanoate metabolism
pdk00660  C5-Branched dibasic acid metabolism
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
Module
pdk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADK2_17765 (sucC)
   00640 Propanoate metabolism
    PADK2_17765 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PADK2_17765 (sucC)
Enzymes [BR:pdk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PADK2_17765 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFM65832
Position
complement(3839137..3840303)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAQQWLGKNLVTYQTDANGQPVSKILVESCTDIDKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPYQGRELAFQLGLKGDQIKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNALYRQPKLRAMHDPSQDDA
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggctttgccgtagacacccccgaagaggccgcagaagcctgcgacaagatcggcggc
agcgagtgggtcgtcaaagctcaggtgcacgccggcggccgcggtaaagcgggcggtgtg
aagctggtgaagagcaaagaggacgccaaggcgttcgcccagcagtggctgggcaagaac
ctggtgacctaccagaccgacgccaacggccagccggtcagcaagatcctggtggagtcc
tgcaccgacatcgacaaggagctgtacctcggcgccgtcgtcgatcgttccagccgccgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaggtcgcccacgacact
cccgagaagatcctcaaggctaccatcgacccgctggtcggcgcgcagccgtaccagggc
cgcgagctggccttccagctgggcctgaagggcgaccagatcaagcagttcacccatatc
ttcgtcggcctggcgaagctgttccaggactacgacctggccctgctggaagtgaacccg
ctggtgatcaagaaagacggcaacctgcactgcctggatgccaagatcaacatcgacagc
aacgccctgtaccgtcagccgaagctgcgcgccatgcacgacccgtcccaggacgacgcc
cgtgaagcccatgcgcagaagtgggagctgaactacgtcgcgctggaaggcaacatcggc
tgcatggtcaacggcgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgcgaccaaggagcgcgtgaccgaa
gcgttcaagatcatcctgtccgacagcaacgtgaaggctgtcctggtgaacatcttcggc
ggcatcgtgcgttgcgacatgatcgccgaaggcatcatcggcgccgtcaaagaagtcggc
gtgaaggttccggttgtcgtccgcctggaaggcaacaacgctgaactgggtgccaaggtc
ctggccgaaagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcaa
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system