KEGG   Pseudomonas aeruginosa DK2: PADK2_17775Help
Entry
PADK2_17775       CDS       T02161                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PADK2_17775
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADK2_17775
  Amino acid metabolism
   00310 Lysine degradation
    PADK2_17775
Enzymes [BR:pdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PADK2_17775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3842137..3843366)
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPAAQAAAPAAAGGDDAILSPAARKL
AEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAPAKPAAPAAEAPIFAAGDRVEK
RVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFMS
FFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEIE
GGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPM
AVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcagtcaagcgcgacgaactgatcgtcgacatcgag
accgacaaggtggtcatcgaggttctcgccgaggctgacggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggc
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggctgcacaggcc
gccgctccggccgccgctggcggcgacgacgccatcctgtccccggccgcgcgcaagctg
gccgaggaggccggtatcgatccgaacagcatcgccggcaccggcaagggcggtcgcgtg
accaaggaagacgtggtcgctgcggtcgaagcgaagaagaacgccccggccgccccggcc
aagcctgccgccccggctgccgaggcgccgatcttcgccgccggcgaccgtgtcgagaag
cgtgtgccgatgacccgcctgcgggccaaggtcgccgagcgcctggtcgaggcgcagtcc
gccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctgcgt
tcgaagtacaaggacctattcgagaagaagcacaacggcgtgcgcctgggcttcatgtcc
ttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcttccatc
gacggcaacgacatcgtctaccacggctaccaggacatcggcgttgccgtttccagcgac
cgcggcctggtggttccggtactgcgtaacgccgagttcatgagcctggccgagatcgag
ggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaagacatg
accggcggcaccttcaccatctccaacggtggcgtgttcggttccctgctgtcgaccccg
atcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccgatg
gccgtgaacggccaggtggtgatcctgccgatgatgtacctggcgctgtcctacgaccac
cgtctgatcgacggcaaggaagcggtgagcttcctggtggcgatcaaggacctgctggaa
gatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system