KEGG   Pseudomonas aeruginosa DK2: PADK2_17795Help
Entry
PADK2_17795       CDS       T02161                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00020  Citrate cycle (TCA cycle)
pdk00190  Oxidative phosphorylation
pdk00650  Butanoate metabolism
pdk01100  Metabolic pathways
pdk01110  Biosynthesis of secondary metabolites
pdk01120  Microbial metabolism in diverse environments
pdk01130  Biosynthesis of antibiotics
pdk01200  Carbon metabolism
Module
pdk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pdk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADK2_17795
   00650 Butanoate metabolism
    PADK2_17795
  Energy metabolism
   00190 Oxidative phosphorylation
    PADK2_17795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: AFM65838
Position
complement(3848992..3849360)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIF
SLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGVQILW
GM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacaaacttctcgcgctccggcctctacgactggatggcccagcgc
gtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcattgctcac
cccaacatttcctacgcggactggcacggcctgttctcgcagggttggatgcgcatcttc
agcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggaccatctcc
accgactacctgacttcgatggctctcggcaaggcggcgacagtcgtgcgtttcctcttc
caggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtgcagattctttgg
ggtatgtga

DBGET integrated database retrieval system