KEGG   Pseudomonas aeruginosa DK2: PADK2_19205Help
Entry
PADK2_19205       CDS       T02161                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pdk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pdk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4143090..4143644)
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSVLALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAALEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgtcctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgttgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccagcgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccctcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system