KEGG   Pseudomonas aeruginosa DK2: PADK2_24255Help
Entry
PADK2_24255       CDS       T02161                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pdk  Pseudomonas aeruginosa DK2
Pathway
pdk00330  Arginine and proline metabolism
pdk00332  Carbapenem biosynthesis
pdk01100  Metabolic pathways
pdk01130  Biosynthesis of antibiotics
pdk01230  Biosynthesis of amino acids
Module
pdk_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pdk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PADK2_24255
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PADK2_24255
Enzymes [BR:pdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PADK2_24255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFM67114
Position
complement(5214889..5216007)
Genome map
AA seq 372 aa AA seqDB search
MRDKVTGARRWVVKIGSALLTADGRGLDRNAMAVWVEQMVALHCAGIELVLVSSGAVAAG
MSRLGWVSRPSAMHELQAAASVGQMGLVQAWESSFALHGLQTAQVLLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGG
RIERVLDRLRAGERLGTLLTPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSL
LPVGVKAVQGSFRRGEMVVCVDQGGREVARGLVNYSALEAQKILGQPTDAIEALLGYVDG
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgactggcgcgcggcgctgggtggtgaagatcggtagcgccctgctg
acggccgatggccgtgggctggatcgcaatgccatggccgtttgggtcgagcagatggtg
gcgctgcattgcgccggcatcgagctggtgctggtgtcgtccggcgccgtcgccgccggt
atgagccgcctgggctgggtgtcccgacctagcgcgatgcacgaactccaggccgccgcc
tcggtggggcaaatggggttggtgcaggcctgggagtccagcttcgccctgcatggcctg
cagaccgcccaggtgttgctgacccatgacgacctctccgaccgcaagcgctacctgaac
gcccgcagcaccctgcggaccctggtcgagctgggcgtggtcccggtgatcaacgagaac
gacacggtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcactggtg
gccaacctggtcgaggccgacctgctggtgatccttaccgatcgcgacggtatgttcgac
gccgatccgcgcaacaatcccgatgcccaactgatctacgaggcgcgtgccgatgatccg
cagctcgatgcggtggccggcggcagtgccggcgccctggggcgcggcggaatgcagacc
aagctgcgggcggcgcgcctggcggcgcgttccggcgggcatacggtgatcgtcggcggg
cgtatcgagcgtgtcctcgaccgcctgcgcgccggcgaacgcctcggcaccctgttgacc
cctgatcgcagtcgcaaggcggcgcgcaagcaatggctggccggccacttgcagatgcgc
ggcaccctggtgctggacgatggtgcggtgaaggcggtgagccaggatcacaagagcctg
ttgccggttggggtcaaggcggtccagggcagcttccgtcgcggcgagatggtggtctgt
gtggaccagggcgggcgcgaagtggcgcgcggcctggtcaactacagtgcgttggaggcg
cagaagatcctcggtcagccgacggatgccatcgaggccttgcttggctacgtggatggg
ccggagctggtgcatcgcgacaatctagttctggtctga

DBGET integrated database retrieval system