KEGG   Pseudomonas aeruginosa DK2: PADK2_24365Help
Entry
PADK2_24365       CDS       T02161                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pdk  Pseudomonas aeruginosa DK2
Brite
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PADK2_24365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5237725..5238765
Genome map
AA seq 346 aa AA seqDB search
MQSSQLLPLGSLLLSFATPLAQADALHDQARALFKPIPEQVTELRGQPISEQQRELGKKL
FFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGR
AKDLGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIE
AYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLV
KKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGN
AQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctcgcaactgctcccgcttggcagcctgttgctgtcgttcgccacgcccctc
gcccaggccgatgccctgcacgaccaggcccgcgcgctgttcaaacccatccccgagcag
gtcaccgagctacgcggccagcccatcagcgagcaacagcgcgaactcggcaagaaactg
ttcttcgacccgcgcctgtcacgcagccatgtgctcagctgcaacacctgccacaacgtc
ggcaccggcggcgccgacaacgtaccgacgtcggtcggtcacggctggcagaaggggcca
cgcaattcaccgacggtcttcaacgccgtgttcaatgccgcgcagttctgggatggccgt
gccaaggacctgggggagcaggccaagggtccgatccagaacagcgtcgagatgcacagt
accccgcagttggtcgaacagaccctgggcagcatcccggaatacgtggacgccttccgc
aaggccttccccaaggccggcaagccggtcagcttcgacaacatggcgctggccatcgag
gcctacgaggcgaccctggtgactccggactcgcccttcgacctgtatctcaagggcgac
gacaaggccctcgacgcacagcagaagaaaggcctcaaggcattcatggacagtggctgc
agcgcctgccacaacggcatcaacctgggcggccaggcctacttcccgttcggcctggtg
aagaagcccgacgccagcgtgctgcccagcggcgacaagggccgcttcgccgtgaccaag
acccagagcgacgagtacgtattccgcgccgcgcccctgcgcaacgtcgccctcaccgcg
ccgtacttccacagcggccaggtctgggaactcaaggacgcggtggcgatcatgggcaac
gcccagctcggcaagcagttggcgccggacgacgtggagaacatcgtcgccttcctgcac
agcctgagcggcaagcagccgcgcgtcgaatatccgctgctgccggccagcacggagacc
acgccgcgtcccgcggaataa

DBGET integrated database retrieval system