KEGG   Pseudomonas aeruginosa DK2: PADK2_24600Help
Entry
PADK2_24600       CDS       T02161                                 

Definition
epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pdk  Pseudomonas aeruginosa DK2
Brite
Enzymes [BR:pdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PADK2_24600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5299755..5300744)
Genome map
AA seq 329 aa AA seqDB search
MKYAVLGATGLLGHHAARAIRAAGHDLVLIHRPSSQIQRLAYLEPECRVAEMLDHAGLER
ALRGLDGVIFSAGYYPSRPRRWQEEVASALGQTNPFYAACLQARVPRILYVGSAYAMPRH
PQGLPGHEGLFYDSLPSGKSSYVLCKWALDEQAREQARNGLPVVIGIPGMVLGELDIGPT
TGRVITAIGNGEMTHYVAGQRNVIDAAEAGRGLLMALERGRIGERYLLTGHNLEMADLTR
RIAELLGQPAPQPMSMAMARALATLGRLRYRVSGQLPLLDETAIEVMAGGQFLDGRKARE
ELGFFSTTALDDTLLRAIDWFRDNGYFNA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgccgtactcggagccaccggcctgctgggacatcacgccgcgcgcgccatc
agggccgccggtcacgatctggtgctgatccaccgtccttcttcgcagatccagcgtctc
gcctatctggagcccgagtgccgggtcgccgagatgctcgaccacgccggcctggaacgc
gccctgcgcggcctcgacggggtgatcttcagcgccggctactatccttcgcggccgcgc
cgctggcaggaggaagtggccagcgcgctgggccagaccaacccgttctatgccgcctgc
ctgcaggccagggtgccgcgcatcctctatgtcggttcggcatatgccatgccccgccat
ccccagggactaccgggccacgaggggttgttctacgacagcctgccgagcggcaagagt
tcctacgtgctgtgcaaatgggcgctcgacgagcaggcccgggagcaggcgcgcaacggc
ctgccggtggtgatcgggattcccggcatggtactcggcgaactggacatcggcccgact
accgggcgcgtgatcaccgccatcggcaatggcgagatgacccactacgtcgccggccag
cgtaacgtcatcgatgccgccgaagccgggcgcggactgctgatggcccttgagcgcggg
cgtatcggcgagcgctacctgctgaccgggcacaacctggaaatggccgacctgacccgg
cgcatcgccgagctgctcggccagcctgcgccgcagccgatgtcgatggccatggctcgc
gcgctggccaccctgggccgcttgcgctaccgggtcagcggccagttgccgctgctcgac
gaaaccgccatcgaggtgatggctggcgggcagttcctcgatggacgcaaggcccgcgag
gaactcggcttcttctccaccaccgccctcgacgacaccctgctgcgcgccatcgactgg
ttccgcgacaacggctatttcaatgcctag

DBGET integrated database retrieval system